KEGG   Lawsonella clevelandensis: AL705_04245Help
Entry
AL705_04245       CDS       T04080                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cbq  Lawsonella clevelandensis
Pathway
cbq00564  Glycerophospholipid metabolism
cbq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AL705_04245
Enzymes [BR:cbq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AL705_04245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 Thi4 Pyr_redox GIDA Pyr_redox_3 3HCDH_N NAD_binding_8 HI0933_like GMC_oxred_N HTH_28
Motif
Other DBs
NCBI-ProteinID: ALE18979
UniProt: A0A0M5L7S6
LinkDB All DBs
Position
936736..938469
Genome map
AA seq 577 aa AA seqDB search
MSAPSELTLELRESNWDRLGSEQFDILIIGGGSVGAGAALDAATRGLKVAMVEARDLACG
SSSRSSKMFHGGLRYLQPNPIPQFGLVAESLHERELSMHTLAPHLVKPLKFIYPLTTPFF
ERIMMFCGFTLYDRMGGAKTVPMQKHFSRKKILKKIPSLKPNATCGGVQYYDTLVDDARH
TMMVTRTAAKYGAVIRTSTQVVDFLKEGDRVVGVTIKDTEDGRTQNVKASAVINATGVWT
DEMQNLAGAKAKFHVHQSKGIHIVVPKDRIKSDSALCFVTEKSVLFVIPWGNYWIVGTTD
TSWKLDLAHPAATKTDIDYVLEELNSRLQEPVTYADIVGVYAGLRPLVAQAGQENTEKLA
RNHEVARLCPGLVSVAGGKYTTYRVIGKDAVEAAIKDVPGQVAKSTTEETPIIGADGYWA
LTNQLDALAAKYGITEDQVEHLLNRYGSLIFDVLSYAKNDASLKKPITNAEGYLRVEAVY
AAAVEGALHLEDVITRRTRISIEYDDRGMDSAQEIADLIAPVLGWDDATKEKEVKLYRDR
VVAELNSQKAITDEEADALRNQAEEARPAYVDDVDKK
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgcaccgtccgaactcactcttgagcttcgcgaatccaactgggatcgcctcggc
tccgaacaattcgacattctcatcatcggcggcggttccgtcggtgcaggcgccgctctc
gacgccgccacccgtggcctgaaggttgccatggtcgaggctcgcgacctcgcctgcggt
tcctctagccgttcatctaagatgttccacggtggcctgcgctacctgcagccgaacccg
atcccgcagttcggcctggttgctgaatctctgcacgagcgcgagctttccatgcacacc
ctggcaccgcacctcgttaaaccgctgaagttcatctaccccctcaccacgccgttcttc
gagcgcatcatgatgttctgtggcttcaccctctacgaccgtatgggtggcgccaagacc
gttccgatgcagaagcacttcagccgcaagaaaatccttaagaagatcccttctctcaag
cccaatgccacctgcggtggtgtgcagtactacgacaccctcgtagatgacgcccgccac
accatgatggtgacccgtaccgccgctaagtacggtgctgtcatccgtacctccacccaa
gtcgtcgacttcctcaaggaaggcgaccgcgtggtcggcgtcaccatcaaggacaccgaa
gacggccgcactcagaatgtgaaggcctctgccgtcatcaacgccaccggcgtgtggacc
gacgaaatgcagaacctcgccggcgccaaggccaagttccacgtccaccagtccaagggc
atccacatcgtggtccccaaggatcgcatcaagtccgactccgccctgtgcttcgtcact
gagaagtccgtactgttcgtgattccgtggggcaactactggattgtcggcaccaccgac
acctcctggaagctggacctggcccacccggccgccaccaagaccgacatcgactacgtc
ctggaagagctcaactcgcgcctccaggaacccgtcacctacgccgacatcgtcggtgtg
tacgccggtctccgcccgctcgtcgcccaggctggccaggagaacaccgagaagctcgcc
cgcaaccatgaagttgcacgcctgtgccccggcctcgtctccgtcgccggcggtaagtac
accacctaccgtgtcatcggcaaggatgccgtcgaagctgccatcaaggacgttcctgga
caggtcgccaagtccaccaccgaagaaacccccatcataggtgctgacggctactgggcc
ctgaccaaccagctcgacgccctcgccgccaagtacggcatcaccgaggatcaggttgag
cacctcctcaaccgctacggctccctcatcttcgacgtgctctcctacgccaagaacgat
gcgtccctcaagaagcccatcaccaacgccgaaggctacctccgcgtcgaggctgtctac
gccgctgcggtggaaggtgccctgcacctcgaggacgtcatcacccgccgtacccgcatc
tccatcgaatacgatgatcgcggcatggattccgcccaggagatcgccgacctcatcgcc
cccgtcctcggctgggacgatgccaccaaggagaaggaagttaagctctaccgcgaccgc
gtcgtcgccgagctcaactcccagaaggccattaccgacgaagaagccgacgccctccgc
aaccaggccgaggaagcccgcccggcctacgttgacgacgtcgacaagaagtaa

DBGET integrated database retrieval system