KEGG   Lawsonella clevelandensis: AL705_06285Help
Entry
AL705_06285       CDS       T04080                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cbq  Lawsonella clevelandensis
Pathway
cbq00020  Citrate cycle (TCA cycle)
cbq00480  Glutathione metabolism
cbq01100  Metabolic pathways
cbq01110  Biosynthesis of secondary metabolites
cbq01120  Microbial metabolism in diverse environments
cbq01130  Biosynthesis of antibiotics
cbq01200  Carbon metabolism
cbq01210  2-Oxocarboxylic acid metabolism
cbq01230  Biosynthesis of amino acids
Module
cbq_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AL705_06285
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AL705_06285
Enzymes [BR:cbq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AL705_06285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ALE19237
UniProt: A0A0M4MCN5
LinkDB All DBs
Position
1460755..1461975
Genome map
AA seq 406 aa AA seqDB search
MSKIHVDGTVVELDGDEMTRVIWQDIRDELILPYLDLNLEYYDLGIESRDASDDQITIDA
ANAIKKHGVGVKCATITPDEARVAEFGLKKMWKSPNGTIRNILGGTIFRAPIIMANVPRL
VPGWTKPIIIGRHAFGDQYRATDFKAPSAGTVTITFTPDDGSEPIQHEVVRLPEDGGVVM
GMYNFNKSIEDFARASFNYGLSMNYPVYLSTKNTILKAYDGQFKDIFQRIYDEEFKAQFE
AAGLHYEHRLIDDMVASALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLTPDG
KTCEAEAAHGTVTRHYRQHQAGNPTSTNPIASIYAWTRGLAHRGKLDSNQELVGFANTLE
TVIVDTVEGGQMTKDLALLVGGDQEWLTTEQFMEALITNLGKKLAV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagatccacgtcgacggcactgtcgttgaactcgacggtgacgagatgacccgt
gtcatctggcaagacattcgtgacgaactgatccttccctacctcgaccttaacctcgag
tactacgacctcggcattgagagccgtgacgccagcgacgaccagatcaccattgatgct
gccaacgccatcaagaagcacggtgttggtgtaaagtgcgccaccatcacccccgatgag
gcccgcgttgcagaattcggcctgaagaagatgtggaagtcccccaacggcaccatccgt
aacatcctcggtggcaccatcttccgcgcccccatcatcatggcaaatgtgcctcgtctg
gttcccggctggaccaagcccatcatcatcggccgtcacgccttcggtgaccagtaccgc
gccaccgacttcaaagcccccagcgccggcactgtcaccatcaccttcaccccggatgat
ggctccgaacccatccaacacgaagtggtgcgcctccccgaagacggcggcgtcgttatg
ggcatgtacaacttcaacaagtccattgaggacttcgctcgcgcctccttcaactacggc
ctgagcatgaactacccggtgtacctgtctaccaagaacaccatcctcaaggcctacgac
ggccagttcaaggacatcttccagcgcatctacgacgaagagttcaaggcacagttcgag
gccgccggcctacactacgagcaccgcctcatcgacgacatggtcgcctccgcccttaag
tgggaaggcggctacgtctgggcctgcaagaactacgacggcgacgtccagtccgacacc
gtcgcccagggcttcggctccctcggtctcatgacgtccgtcctcctcacccccgacgga
aagacctgcgaggcagaagccgcccatggcaccgtcacccgccactaccgccagcaccag
gccggtaaccccacctccactaaccccatcgccagcatctatgcctggacgcggggcctt
gcccaccgcggcaaactggacagtaaccaggaactcgtcggcttcgccaacaccctggag
acggtcatcgtcgacactgtcgaaggcggccagatgaccaaggacctcgccctcctcgtg
ggcggtgaccaggaatggctcaccaccgaacagttcatggaagccctcatcactaacctt
ggaaagaaactggcggtctag

DBGET integrated database retrieval system