KEGG   Caenorhabditis briggsae: CBG01813
Entry
CBG01813          CDS       T01054                                 

Gene name
Cbr-ced-3
Definition
(RefSeq) C. briggsae CBR-CED-3 protein
  KO
K20106  cell death protein 3
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr04215  Apoptosis - multiple species
cbr04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    CBG01813 (Cbr-ced-3)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CBG01813 (Cbr-ced-3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cbr01002]
    CBG01813 (Cbr-ced-3)
Peptidases and inhibitors [BR:cbr01002]
 Cysteine peptidases
  Family C14: caspase family
   CBG01813 (Cbr-ced-3)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 8576238
NCBI-ProteinID: XP_002634243
WormBase: CBG01813
LinkDB
Position
IV
AA seq 507 aa
MRPDRRSLLERNILEFSSKLQADLILDVLIAKQVLNSDNGDVINSCRTERDKRKEIVKAV
QRRGDVAFDAFYDALRDTGHNDLADVLMPLSRPINCAVNPVPMECPMSPSSHRRSRALSP
PRYASPTRVHRDSISSVSSFTSTYQDVYSRARSSSRSSRPLQSSDRHNYMSAATSFPSQP
SSANSSFTGCASLGYSSSRNRSFSKTSAQSQYIFHEEDMNYVDAPTIHRVFDEKTMYRNF
SSPRGLCLIINNEHFEQMPTRNGTKADKDNITNLFRCMGYTVICKDNLTGREMLSTIRSF
GRNDMHGDSAILVILSHGEENVIIGVDDVSVNVHEIYDLLNAANAPRLANKPKLVFVQAC
RGERRDNGFPVLDSVDGVPSLIRRGWDNRDGPLFNFLGCVRPQVQQVWRKKPSQADMLIA
YATTAQYVSWRNSARGSWFIQAVCEVFSLHAKDMDVVELLTEVNKKVACGFQTSQGSNIL
KQMPELTSRLLKKFYFWPEDRSRNSAV
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgcgtccggatagacggagtttgctggagagaaacattctagagttctcttctaaacta
caggccgacttgattctcgatgttctcattgccaaacaagttctcaactctgataacggt
gatgtaataaattcgtgtcgaaccgaacgcgataagcgaaaagaaatcgtcaaagctgtt
caaagacgtggagatgttgcgttcgacgcattttatgacgctctacgcgatacaggacac
aacgatcttgccgatgtcctcatgcctctttctagaccgattaactgtgctgttaatccg
gtcccgatggaatgcccgatgtctccttcaagtcatcgtcgtagccgagcactcagtcca
cctagatatgcatcacctacccgtgttcaccgggatagcatctcgtcggtttcatcgttt
acatctacctatcaggatgtatattcccgagcacggtcaagttcgcggtcgtctcgccct
cttcaatcatctgatcgtcataattatatgtcagcagctacttccttccccagtcaaccc
tcatctgcgaattcttctttcaccggatgcgcttcactcggctatagttctagtcggaat
cgttcgttcagcaagacgtcggctcagtcacaatacattttccacgaagaagacatgaat
tacgtcgatgcgcccaccatacaccgcgtttttgacgaaaagacgatgtatcgcaacttt
tcgagcccccgtggattatgcctcataataaacaacgaacatttcgagcagatgccaact
agaaacggcacgaaagccgataaggacaacataacgaatttgttcagatgcatgggatat
accgtcatatgcaaagacaatctgaccggcagagaaatgttgagcactattcgaagcttc
ggaagaaacgatatgcatggagattctgcaatactcgtcattttgtcgcacggagaagag
aacgttattatcggagttgatgatgtttctgtaaacgttcacgaaatttacgatctcctg
aatgctgccaatgctcctcgtttggccaataagccgaaactggtgtttgttcaagcatgt
cgaggcgagcgtcgtgacaatggcttcccggttcttgattcagttgatggagtacctagt
ctgatccgtcgcggatgggataatcgagacggaccattgttcaattttcttggatgtgtc
cggccccaagtgcagcaagtatggcggaaaaagccgagccaagcagacatgttgattgct
tatgcaacaacggctcaatatgtgtcatggagaaacagtgctcgtggttcgtggttcatt
caagctgtttgtgaagtattctcacttcacgctaaagatatggacgtcgttgaattgctc
actgaggttaacaagaaagttgcctgtggattccagacatctcaaggatcaaacatattg
aagcagatgccagagctaacttcaagactcctgaaaaagttctacttctggccggaagat
cgaagccggaacagtgcagtctag

DBGET integrated database retrieval system