KEGG   Caenorhabditis briggsae: CBG04507Help
Entry
CBG04507          CDS       T01054                                 

Gene name
Cbr-abl-1
Definition
(RefSeq) C. briggsae CBR-ABL-1 protein
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    CBG04507 (Cbr-abl-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cbr01001]
    CBG04507 (Cbr-abl-1)
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     CBG04507 (Cbr-abl-1)
Protein kinases [BR:cbr01001]
 Non-receptor tyrosine kinases
  ABL family
   CBG04507 (Cbr-abl-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 F_actin_bind SH3_9 SH3_2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 8586137
NCBI-ProteinID: XP_002644142
WormBase: CBG04507
LinkDB All DBs
Position
X
AA seq 1183 aa AA seqDB search
MIMNPCFRERSQKRTKKRPKPRTKSRSTMYLSRVGDSSPAMSRSLPSVALPMHYLHHKLA
ESICFITATIDSLEDLVACSSMNSVNNTHDMNTVSSSSSSSAPLFVALYDFHGVGEEQLS
LRKGDQVRILGYNKNNEWCEARLYSTRKNDASSQRRLGEIGWVPSNFIAPYNSLDKYTWY
HGKISRSDSEAVLGSGITGSFLVRESETSIGQYTISVRHDGRVFHYRINVDNTERMFITQ
EVKFRTLGELVHHHSVHADGLICTLMYPASKKDKTRGLFSLSPNAPDEWELDRSEIIMHN
KLGGGQYGDVYEGYWKRHDCTIAVKALKEDAMPLHEFLAEAAIMKDLHHKNLVRLLGVCT
HEAPFYIITEFMCNGNLLEYLRRTDKTLLPPIILVKMASQIASGMSYLEARHFIHRDLAA
RNCLVSEHNIVKIADFGLARFMKEDTYTAHAGAKFPIKWTAPEGLAFNTFSSKSDVWAFG
VLLWEIATYGMAPYPGVELSNVYSLLEHGFRMDGPQGCPPSVYRLMLQCWNWSPSDRPRF
RDIHYNLETLITTNSFEEDVQKQLKKSSEKKLESERRRSSHVRERSDSKTRHSSHHDRDR
DRESLHSRNSNPELANKNFMRNDDGGMFFNQPSSGSKVTSFRSQVPYPAPPQQSAKPKLL
KSVLSSNARHASEEFDRNEQDDIVPLAEKNVRKAVTRLGGTMPKGQRIDAYLDSMRRVDS
WKESTDADNEGAGSSSMSRTVSNDSLDTLPLPDSMTSSTYGKMHPVVGENVFLRQIRSKL
KKRGETPELDHIDSDTADETNKSDKTSPFGSLNKSSVKYSLKNGSDFNNRHSRASPVPVP
VPPSRNASVSVKVESKAEDSSDETTKDGMWGPKHAVTRKIEIVKADSYQNVEGELKAKIR
NLRHVPKEENHDDSPLDATDTTNDSAIALPPNEKARVRQLVTQKVSPLQHHRPFSLQCPN
NSTSSALSHSEHADSSETSSLSEIQEEKMKSELARKSNGETKVVPVTWMINGGDKERESN
RMSRTKSLRDITTKFEQLGTPSSAVESKIEEAPYREHALEKKGGSTKRFSMMEGNGELKH
VVPSRKNRNLEESGSIEEEPVSKDIIVSLLRVIQKDFVNLSNLASSELTDEKLQQFVMEL
LSQLETYNRQIKFSHNPKAKPVDGKLVMAFQDCFDQIMRLVDR
NT seq 3552 nt NT seq  +upstreamnt  +downstreamnt
atgattatgaatccgtgcttccgagaacggtctcaaaagcggacgaaaaagcggccgaaa
ccgcgaaccaagtctcggagcacaatgtacctgtctagggttggtgattcatcacccgca
atgtcacggagtctaccatctgtcgcattaccgatgcactatttgcatcacaaattggca
gagagcatctgctttatcacggctaccatcgactcattagaagacttggtagcatgtagc
tcgatgaactcggtgaacaatacacacgacatgaatacagtatcctcatcgtcttcctca
tcggcaccgctcttcgtggcactctacgatttccatggagtcggtgaagagcagctttca
ttgagaaagggtgatcaggtgcgaattctgggatacaacaaaaacaatgagtggtgtgaa
gcgcggctatattcgacaaggaaaaacgacgcgagcagtcaacgacgtctaggagagatt
ggatgggttccaagcaatttcatagctccatacaactctctggataagtacacgtggtat
catgggaagatatccagaagtgattcggaagcagttctcggcagtgggatcaccggatcg
tttttggttcgagaaagtgaaaccagtattggacagtataccatctcggttcgacatgat
ggtcgggtgtttcattatcggataaacgtggataacacggaaaggatgttcatcacgcag
gaagtcaaattccgcacacttggcgagttggtgcatcatcatagtgttcatgccgacgga
ctaatatgtactttgatgtatccggcgagtaagaaggacaagacacggggactgttttcg
ttgtcaccaaatgcgccggatgaatgggaactggatagatcggaaatcatcatgcataac
aaattgggtggcggacagtatggagatgtgtacgagggctattggaagcgacatgattgc
acaattgcggtgaaggcgttgaaagaggatgcgatgccgttgcatgagtttttggcagaa
gcggcgattatgaaggatttgcatcataaaaatctggtccgtctcctcggcgtttgcacc
catgaagctccattctacatcatcaccgaatttatgtgcaatggaaatttgctcgagtac
ttaagaagaaccgataaaacacttcttccaccgatcattctggtcaagatggccagtcag
atcgcctcgggaatgtcatacctagaagcaaggcattttatacatcgggacttagccgct
aggaattgtcttgtgtctgagcacaacattgtgaagattgctgatttcgggttagctcga
tttatgaaagaagacacgtatactgcacacgccggagcaaaattccctatcaaatggaca
gctccagaaggcttggcattcaacacgttcagctcaaagtcagatgtatgggcgtttgga
gtactactctgggagatcgccacttatggaatggctccatatccgggagttgaattgtca
aacgtttatagtctacttgaacacgggttccgaatggatggaccacaaggatgtccaccg
tcggtgtataggctcatgttgcaatgctggaattggtcaccatccgatcgtccacgcttc
cgcgatattcattataacttggagacactaatcacaacgaattcgtttgaagaagacgtc
cagaaacaattgaaaaagagcagtgagaagaaattggagtcagaacgaagaagatcgtcg
catgttagagaaaggagtgattcaaaaacgagacattcttcacatcatgatagagatcgc
gatcgagaatctctccactcccgtaattccaacccagagctcgctaataagaatttcatg
cggaatgatgacggtggaatgttcttcaatcaaccatccagcggtagcaaagtgacatcg
ttccgctcccaagtaccatatccagcacctccacaacagagtgctaagccgaaacttctg
aagtcagttctaagtagtaatgctcgtcacgcatcggaggagtttgataggaatgaacag
gatgatattgttccgttggctgagaagaatgtgaggaaagcggtcacacgcctaggtgga
accatgccgaaggggcaaaggatagatgcgtatttggactcgatgagacgagtggatagt
tggaaagaaagcaccgatgctgataacgagggagccggatcatcttctatgagtcgtaca
gtgtccaacgattctctggacacactgccacttccagactccatgacttctagcacctac
ggaaaaatgcatccggtagttggagaaaacgtgttcttacgacaaattcgttctaaactg
aaaaagcgtggtgagacgccagaattggatcatattgattcggatactgctgatgaaacc
aacaaatcggacaaaacatcgccatttgggtcgctcaacaagtcatctgtcaaatattcc
cttaaaaatggatcagatttcaacaacaggcactcgagagccagtccggtccctgtacca
gtacccccatcacgtaacgcgtcggtcagtgtcaaagttgaatccaaagctgaagattcg
tcagacgaaacaacaaaagatggcatgtggggtcccaagcatgcggtgacccggaaaatc
gaaatcgtaaaagccgactcctaccaaaatgtagaaggcgaactaaaagcaaaaatccgc
aacttgcgtcatgtgccaaaggaggaaaatcacgacgactccccgttagatgccacagat
accactaacgatagtgcaattgcgttgccaccaaacgaaaaagctcgagttcgacagttg
gtaactcaaaaagtgtcaccactccaacatcatcgtcccttctcacttcaatgcccaaat
aactctacaagttcggctctatctcattcagagcacgcggatagttcagaaacgtcgtct
ctttctgagatacaggaggagaaaatgaagtcagaactggctagaaaaagtaatggagag
accaaagtggtgccagtcacttggatgatcaatggaggggataaagaaagagagtcgaat
aggatgtcacggacgaagtcgttacgggacattaccaccaaatttgagcagctcgggacc
ccatcgtcggctgtggagagtaaaattgaagaagctccatatcgggaacatgctcttgaa
aagaaaggtggatccacgaagagattctcaatgatggaaggaaatggtgaactgaagcat
gtggtgccgtcacgcaagaaccggaatctggaagagtctggctctattgaggaagagcct
gttagcaaggatatcattgtatctctactccgcgtcattcaaaaggattttgtgaatttg
tcaaatctggcgagctccgagctcactgatgagaaacttcagcagtttgtgatggaactc
ctatctcaattagagacctacaatcgtcaaataaagttttcacacaatccaaaagcaaaa
ccagttgatggaaaattggtgatggcgttccaagactgtttcgatcaaatcatgcgtctt
gtggatcgatga

DBGET integrated database retrieval system