KEGG   Caenorhabditis briggsae: CBG04615
Entry
CBG04615          CDS       T01054                                 

Gene name
Cbr-egl-1
Definition
(RefSeq) C. briggsae CBR-EGL-1 protein
  KO
K20104  programmed cell death activator egl-1 EGL-1
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    CBG04615 (Cbr-egl-1)
SSDB
Motif
Pfam: EGL-1 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 8579823
NCBI-ProteinID: XP_002637826
WormBase: CBG04615
UniProt: A8WY25
LinkDB
Position
V
AA seq 110 aa
MLTFASTSTSDLFSMPSSQFEYIKPSYDKKMFNFSSSSDDAVTSSSDFADDSGFFDDSDE
SSHTISSIGHDIGTKLAAMCDAFDAEMMSYSRRRDTSRSLLNRVLDFFAF
NT seq 333 nt   +upstreamnt  +downstreamnt
atgctcacattcgcctcaacttctacttctgatctcttctcgatgccttcatcccaattc
gagtacatcaaaccttcctacgacaagaagatgttcaacttctcttcttcctctgatgac
gccgtgacgtcttcttctgatttcgctgacgattctggattttttgatgactccgacgaa
tccagccacaccatcagctccatcggtcacgacatcggcaccaagctggcagccatgtgc
gatgctttcgacgccgaaatgatgtcctactccagaagacgtgacacctccagaagcttg
ctcaaccgtgtgctcgacttcttcgccttctaa

DBGET integrated database retrieval system