KEGG   Caenorhabditis briggsae: CBG09006Help
Entry
CBG09006          CDS       T01054                                 

Gene name
Cbr-wrm-1
Definition
(RefSeq) C. briggsae CBR-WRM-1 protein
  KO
K02105  catenin beta 1
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    CBG09006 (Cbr-wrm-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 8583146
NCBI-ProteinID: XP_002641153
WormBase: CBG09006
UniProt: A8X811
LinkDB All DBs
Position
III
AA seq 799 aa AA seqDB search
MEERGPDIEKYGSQPCTPLSFDPMLPSTSRVATPVRPSSTLSARQAPASPFRAQPQNMEP
SISRVHELREGAAVKRSYTNDWMQGNYIPPNPQQQQYQRPPSMIGSTISNMSNLSHMTKF
SALSVNTQCGQFDNWIYQSQPALSKVSHSSVENQDPMKRRERMSIPEIVQSLASYEMSDQ
VAAIRELEPLAKAEALESTYCQADLGKIINALFEVLVPRPQENENVIRKVFEILHRAAVP
KHVRMTEKIFHSLNLELMNTNSSKHSFQVPRPYSIYELVIERASRLDTAYDQAAMLLLAQ
ICCKPFFMKYVFSEKEQSAGHRRLHEVVMQFAIKNLQQQETKRKSKGFCVSIIKNLSRRN
RSIWSIVYELHVIPIFHDIIKDEYSDEDLLWPTMQALTTFCSIERVGEDFVKLGGAQDLC
NLLYHGSTRLLHELLACMQRLSLLQEIGNQDMEESIRRVIQVVGSDDATIAERATGVLRN
IGQPNKQNKVIMVRNGVTAHAIAVLRTSMRFQSQLREQQNARTPKNQIDAAKNQILSIYE
NCLSILNNVTKMGKDDILDSAIQACRMISANPDAAIVLLHFLNAGAPKCRKLAVNVMKRV
IENVPAFAEPFVDLPGTTQETLPILLLKRAYESLDEWKKAVVEVMRSEPNTQQFRDAIEK
RQDHEDIVWKSVSLLSNLCRNGNPRFFERVKVEMLYTRPTNPFTSLFPEMSDVILYEWLD
FILAICGTEWSLQNCLMYHFLKQANITHEYLLHYRRPNPQICDKIKNIIDTGMRQQQQHN
QLEQMAMMHAQQQHQQLPM
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcgaggtccagatatagaaaagtacggatcccaaccatgcactcccctatca
ttcgacccaatgctgccatcaacatcacgagtggcgactccagtgagaccatcttccaca
ttgtctgctcgacaagctcccgcgtctcccttccgagcacaaccacaaaacatggagcca
tcgatatcacgggttcatgagcttcgagaaggcgctgctgtaaaaagatcgtacacgaat
gattggatgcaaggcaactacattcccccgaatccacagcaacaacaatatcaacgaccg
cccagtatgattggttcaacaatttcaaatatgtcaaatttgtcgcatatgaccaagttc
tctgcactgtctgttaacacgcaatgcggacagtttgacaattggatttatcaatcgcaa
ccagcgctttcgaaagtgtcgcattcatcagttgagaatcaagatccgatgaagagaaga
gaacggatgagtattccggaaatcgtacaaagcctggcatcgtatgaaatgagtgatcaa
gttgctgctattcgagaactggagccacttgcaaaggcggaagcacttgagtcgacttat
tgccaagctgatttgggaaaaatcatcaatgctcttttcgaagtattggtgccgagaccg
caagaaaacgagaacgtgatccgtaaagtattcgaaatactccatcgtgctgcagtacca
aaacatgtgaggatgacggagaagattttccactcgctcaatttagagctgatgaacaca
aattcatcgaagcacagttttcaagtgccaagaccgtacagcatctacgaattggtgatt
gagagagcctcacgtttggacacggcttacgatcaggccgcgatgcttctcctggctcaa
atatgctgtaaaccctttttcatgaagtacgtgttctctgaaaaggaacaatccgctggc
cacagacgtcttcatgaagtggtaatgcaattcgccatcaagaacttgcaacaacaagaa
acaaagcgaaagagcaaaggattttgcgtatccatcatcaagaacctatctaggagaaac
cgttcgatatggagcattgtttatgaactgcatgtcatcccaatctttcatgatatcata
aaggatgagtacagcgatgaagatctcctctggccaactatgcaagcgttaaccacgttc
tgctcgatcgaaagagttggagaggactttgtgaagttgggaggtgcccaagatttgtgt
aatcttttgtaccatggatccactcggctacttcatgaactgttggcttgtatgcaaaga
ttgtccttgcttcaagaaattggaaatcaagatatggaagagtcaattcgaagggtgata
caggtggttggctctgatgatgcgactattgctgagcgagcgacaggagtgcttcggaat
attggacaacccaataagcagaacaaagtcatcatggtgcggaatggggtgaccgcccac
gcgatagccgttttgcgcacttcgatgcgtttccagtctcagctaagagagcagcaaaat
gcgagaactccaaaaaatcagatcgacgctgcaaaaaatcagatcttgtccatctatgaa
aattgcctatcgattctcaacaacgtcacaaaaatgggcaaagatgatatcctggactct
gctattcaggcatgccgaatgataagtgcaaatccggatgctgcaattgtcttgctccat
ttcttaaacgccggagccccaaaatgcagaaagctcgctgtgaacgttatgaagcgggtc
atagagaacgttccagcatttgccgagccgtttgttgatctccccggaacgacccaggaa
acgctgcctattcttttgttaaagagggcatatgagagtttggatgaatggaagaaagca
gttgtggaagttatgcgatccgaacccaacactcagcaattccgagatgccattgagaag
aggcaagatcacgaggatattgtgtggaagtcggtcagcctcctatcgaacctctgtcga
aatggaaatccacgattcttcgagagagttaaagtggagatgctctatacccgtccgacg
aacccgttcacttcgctatttccggaaatgagcgacgtcattctctacgaatggcttgac
ttcattttagctatctgcggcaccgagtggtctctacagaactgcttaatgtaccatttc
ctgaagcaagcgaacatcacacatgaatatttgcttcactatcgtcggccgaatcctcag
atctgcgacaagatcaagaatattatcgataccggcatgagacagcaacaacagcacaat
caactagagcaaatggcaatgatgcatgcgcagcagcagcaccaacagctaccaatgtga

DBGET integrated database retrieval system