KEGG   Caenorhabditis briggsae: CBG10985Help
Entry
CBG10985          CDS       T01054                                 

Gene name
Cbr-bar-1
Definition
(RefSeq) C. briggsae CBR-BAR-1 protein
  KO
K02105  catenin beta 1
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    CBG10985 (Cbr-bar-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3361 DUF3585 Cnd1
Motif
Other DBs
NCBI-GeneID: 8586998
NCBI-ProteinID: XP_002645000
WormBase: CBG10985
UniProt: A8XBZ8
LinkDB All DBs
Position
X
AA seq 808 aa AA seqDB search
MDLDPNLVINHDDTNLSEISYTMEQDSSSYSLEMGGTPSSAGHRKVDMWQNHNFDSGFQT
MNHSEAPSIISSLHPSSHLSGMSSMAEYEPIPNLSEQQKQKFDGITKNPTDGQYNTVRAI
PELTMLMKDQDNEVVQKAVMIMQNIAKMECDAMRRQNETKIVDPCVIFTLRNLLRDKVDH
PNIIRFTLGTLFNICNRQEGIDLVTRAISEQPDIIPNLIRHIGTFANSIYKYAILTMHSI
LSDKQRGGQSVTIARQQDAIIHVTPWLEAEKSEKLLPVIVDLIRVLCEKNTDQKVKFVKM
GGPQKLLHILQQRGYENLLWRSTQLLKTFSNFDAPCLVAFGGRQILAGMLSHGSPRLVLS
TLETLRNISDVPSKMKEELLLKSLLELVNSRNAVIRLYSAQTMSNLVANNRPNKEYMCSN
NGVVNLCRALAIATKDWQNFQDKEAQQMEDYAESLICTLRHLCVGHPLAEKVQAYVFREP
SIFLHKLMTMRPVLLKHTLNLLLKVVSQNALLAPFLLCRIGEIGFVEQLIHILRVACTQL
NVQDVIEGVRVKDIVHLCIQILRLITRNPDILNEVDFFLRSPENSRMGDGHTLPIFVLQK
ANVEENTKSSTLELIYNLMHHEKMADHLERDEILCKMLHSVQMQAANHPELANLAANILK
LMSEKRERNRIHYGRHGSFESQFGHLSVAAQRTEVLNSHGETYEGAGEQWSQPMSDDSMM
ESYCNSSGRDSSKTYNSPMYHSPPSMYPEYPNGPPSGPYYDPHAFTSTRPTPPHYANYDS
PPVYNNIPSNQGPSSHLSDQYPYRQGRF
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggacctggatccgaacctagttatcaaccatgacgatacgaacttgtctgagatatca
tatacaatggaacaagactcatcaagttattctttggagatgggcggaacaccgtcatct
gccggtcaccgaaaggtcgatatgtggcagaatcacaattttgacagcggtttccaaacc
atgaatcacagcgaggctccatctattatctcctcgttgcatccctcgtcgcatctgtcg
ggaatgtcctcgatggcagagtacgaaccgattcccaatttgtcagaacagcagaaacag
aagtttgatgggatcaccaaaaatccaaccgacgggcagtacaacacagttcgcgcaatt
ccagaactcacaatgttgatgaaagaccaagacaatgaagtggtccaaaaggctgtgatg
atcatgcaaaatattgcgaaaatggaatgtgatgctatgagacgacagaatgagaccaaa
atcgtagatccatgtgtcatctttacattgcgaaacttgcttcgggacaaagtggatcac
ccgaatattattcgattcactttgggaacacttttcaatatttgtaaccgccaagaggga
attgatcttgtcactagagcaatcagcgagcagcccgacatcattccgaatcttatcaga
catattggtacgttcgcaaattctatctacaaatacgcgattcttactatgcattcgatt
ttgtccgataagcagagaggaggacaaagtgtgaccatcgcgcggcaacaagatgcgatc
attcatgtgacgccttggctggaagcggagaaatcggagaaacttcttcctgttatcgtc
gacttgatcagagttctatgtgaaaagaatactgaccaaaaggtcaagtttgtgaagatg
ggaggaccacagaaactgctccatattctgcaacaacgaggatatgagaatctgttatgg
agaagcactcagttgttgaagacgttctcgaatttcgatgcaccttgtctagtggctttt
ggtgggcgccaaattcttgccggtatgttgtcccacggaagtccacgattagtcctctca
acactggaaacactacgaaatataagtgatgtgcctagcaagatgaaagaggaacttctt
ctaaaatctctgctagaactagtcaattctagaaatgccgttatccgtttatactcagcc
caaactatgtccaacttggtagccaataatcgaccgaataaggaatatatgtgttctaac
aatggtgtggtcaatttgtgtagagcgcttgccattgcaaccaaagactggcaaaatttt
caagacaaggaggctcaacaaatggaagattatgcggaaagccttatctgcacattacgg
catctgtgtgttggccatccgttggcggaaaaagttcaggcttacgtttttcgagagcct
tcgatatttctacacaaactcatgacaatgcgaccagtgttgctgaaacacacgctgaat
cttcttctaaaagttgtgagtcaaaatgcacttttagccccatttctgctttgtcggatc
ggagaaatcggatttgtggagcaactcatccacattttgcgagttgcctgcacacaacta
aatgtgcaggatgtgatagaaggtgtccgcgtcaaggatatcgtgcatttatgtattcaa
attcttcgattgatcacaagaaatccagatattttgaatgaggtggatttcttcctccgt
tccccggaaaacagtcgaatgggcgatggccatactcttccaatttttgtactacaaaaa
gcaaacgtagaagagaacacaaagtcatcaacattagagctgatctacaatctgatgcat
catgaaaaaatggctgatcatctcgagcgagatgaaattctatgcaaaatgcttcacagt
gtacagatgcaagcagcaaatcatcccgaattagcaaatttggcagcaaacattctgaaa
ctaatgtccgagaaacgagaacgcaataggattcattacgggagacacggtagttttgag
agccaattcggacatcttagcgtggctgctcagagaacagaggtgttgaatagtcacgga
gaaacttatgaaggtgctggagagcaatggtcgcagcccatgagcgatgactctatgatg
gaatcatattgtaacagttctggaagggattcgtcgaaaacctacaactctccaatgtac
cactccccgccatctatgtatcctgaatatcctaacggaccaccttcgggaccatattac
gatcctcatgcttttacgtccactcgaccgacacctccgcactatgcaaattatgatagt
cctccagtttataataatattccttctaaccaaggacctagtagccacttgtcggatcag
tatccataccggcaagggcggttttaa

DBGET integrated database retrieval system