KEGG   Caenorhabditis briggsae: CBG13540Help
Entry
CBG13540          CDS       T01054                                 

Gene name
Cbr-daf-18
Definition
(RefSeq) C. briggsae CBR-DAF-18 protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00562  Inositol phosphate metabolism
cbr01100  Metabolic pathways
cbr04068  FoxO signaling pathway
cbr04070  Phosphatidylinositol signaling system
cbr04140  Autophagy - animal
cbr04150  mTOR signaling pathway
cbr04212  Longevity regulating pathway - worm
cbr04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CBG13540 (Cbr-daf-18)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    CBG13540 (Cbr-daf-18)
   04070 Phosphatidylinositol signaling system
    CBG13540 (Cbr-daf-18)
   04150 mTOR signaling pathway
    CBG13540 (Cbr-daf-18)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CBG13540 (Cbr-daf-18)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CBG13540 (Cbr-daf-18)
  09149 Aging
   04212 Longevity regulating pathway - worm
    CBG13540 (Cbr-daf-18)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cbr01009]
    CBG13540 (Cbr-daf-18)
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CBG13540 (Cbr-daf-18)
    3.1.3.48  protein-tyrosine-phosphatase
     CBG13540 (Cbr-daf-18)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     CBG13540 (Cbr-daf-18)
Protein phosphatases and associated proteins [BR:cbr01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    CBG13540 (Cbr-daf-18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 Y_phosphatase DSPc Y_phosphatase3 Herpes_UL21
Motif
Other DBs
NCBI-GeneID: 8576995
NCBI-ProteinID: XP_002635000
WormBase: CBG13540
UniProt: A8XI50
LinkDB All DBs
Position
IV
AA seq 992 aa AA seqDB search
MVDVEPQQEEARPRPEDHLVLSDNQDDMEESENRVAADFVPSTWNKFCQRFRRIISQKRH
RFQFQGLDLDLAYITDRIIAVGYPSSGWEKCIRNTMGHTVEFLKRRHGSGKVKVFNLRGG
FLYDPKKFDDNVIYFDMKDHHPPSLELMAPFCREAYEWLEADKENVIAVHCKAGKGRTGV
MICAFLIYIQFYKNPRQILDYYSIVRTSNNKGVTIPSQRRYIYYYDFMRRKQLNYFPLRQ
ELVGVYLERPPKTRPSQSKVKVKVSNGATVVFTSKPLFINKRNYRKELASWRDSTECNTF
YAGGPPYVSKRAYTFMVPESNRVFVEGDVRVDLLDDDIHLPMADRKIGHVWFNTMFVCKG
MCEGDFVYGDKVWPYENEDTSIGRYKKNLPERDILENKTYKGNWQILKPDKWDEHCPAES
VEKMYTSKQMEIPRDMIIQHLYNAHEKKIVTDDHNDRTLPAGGDAYYPLGVFDPPAEVGG
PFQIPHQRNQHVLTFPVYEMDRALKNKKLNNGMKLHVVLRCIDSKDEAQRELAKAFCDKT
HANTERLGASVANQLHEQYRPVARSADALGAEKKMPPAVRYSKDGGYEGTPSEKLTDEYY
KNKKFASDPRWCRFYYRQRKESPSRWPKLKPICPLTNKMFNFDTDGEEDQDDGSIPPSPA
NDKPTSSTGETTSSGEGAQRSERDETTPKKSPEAKHEEKPEEKEKPEGKAEGTPEEDLKW
YPAQQIIMDDLKSYKTGKDDALVKSLKESIAVSEEAHRKFYDVYRKHGVKDEELEGVAVP
DYSEFVESMEDSEFMHRGVRCEGGGYTFADANSSSAFNDLLDHLAALFSASYDIDRNEFQ
RFDKERIFKMKARRFELEYASADRCQRGYEECVQLDNAIIAYHEREEQRLREIHMHEGSK
MLWLAAWFKTNRQQHGEHAKFDMSKMIAERYEPLTSLTIGKWYRLSDEMDVAIILYITYL
LTPTPGNTQTGPPYFQSLKRNNTSAQYRFQQE
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atggtggacgtagagccacagcaggaagaagcaaggccacgaccggaagaccatcttgtg
ctgagtgacaatcaagacgatatggaggagagtgaaaaccgggtggctgcagattttgtg
ccatctacgtggaacaaattttgccaaagattccggaggatcatctcgcaaaaaagacat
cgttttcaattccaaggactcgatttggatcttgcctacatcactgatcgcataatcgct
gttggatatccatccagtggatgggaaaagtgcatccgtaataccatgggacataccgtc
gagttcttgaaacggcgccatggatcaggaaaagtgaaggtgttcaatctgcgtggaggc
ttcttatatgatccgaagaagtttgacgataatgtcatctactttgacatgaaggaccac
caccctccaagtcttgagttgatggctccattctgtagagaagcttacgaatggctcgaa
gctgacaaggagaacgtgatagctgtccactgcaaagctggtaaaggccgaaccggtgtg
atgatatgcgcattccttatatacatccagttctacaagaaccctcgtcaaattctcgac
tactactctattgtcagaaccagcaataacaaaggtgtcacgattccatcacaacggcgt
tatatctactactatgacttcatgcgcagaaagcagttgaactatttcccactgcgtcag
gagctcgttggagtgtatcttgagcgtccgccaaaaactcgacccagtcaatcgaaggtg
aaagtcaaggtgtcgaatggagcaacagttgtgttcacttcgaaacctcttttcatcaat
aaacgaaactaccgcaaggaattggcatcatggcgagactctactgaatgcaacactttc
tacgctggaggtcctccatacgtttccaaacgtgcttacacattcatggtaccggagagt
aatagagtgttcgtcgaaggagatgtgcgtgtggatcttctcgatgatgacatccacttg
ccaatggcggacagaaagatcggccatgtctggttcaatacaatgttcgtctgcaaagga
atgtgtgaaggtgactttgtctatggagacaaagtctggccatacgaaaatgaggataca
tctattggacggtacaagaaaaacttgccggaaagggacatattagaaaacaaaacgtac
aaagggaattggcagattctgaagcctgacaagtgggacgaacactgtcctgcagagtcg
gtggaaaagatgtacacgagcaagcagatggagataccacgcgacatgatcatccagcat
ttgtacaatgcacatgagaaaaaaatcgtcactgatgaccacaacgaccgtactcttcca
gctggcggtgacgcctactacccattgggtgtttttgatccacctgctgaagtcggaggt
ccattccagatccctcatcaacggaaccaacacgttctcacgttcccagtttacgaaatg
gatcgagcactaaagaacaagaaactgaacaacggtatgaagttgcacgtagttctacgg
tgcatcgattcaaaggacgaagctcaacgcgaactggctaaagctttctgtgacaagact
catgctaatacagagcgtctcggtgcaagtgtagccaaccagttgcacgaacaataccgc
ccagtcgctcgtagtgcagatgcacttggagcagagaagaaaatgcctccagctgttcgg
tactccaaagatggtggttacgagggaacaccttctgagaagctaacggatgaatattac
aagaataagaaattcgctagtgatccaagatggtgtcgcttctactacagacaacgaaag
gagtcgccgagcagatggccaaagctcaagccaatctgtccacttactaacaagatgttc
aacttcgatacagatggagaagaagatcaagatgatggttcaatcccaccaagcccagca
aatgacaaacctacatcttctactggtgaaactacttcgtcaggcgagggtgctcaacgg
tcggaacgtgatgagacgactccaaagaaatcacctgaggcgaaacatgaagaaaagcca
gaagaaaaagagaaaccggaaggaaaagctgagggaactccagaagaagatctgaaatgg
tacccggctcaacagatcatcatggacgacttgaaatcctacaagacaggaaaggacgat
gctctcgttaaaagtcttaaagagagtattgctgtatctgaagaagctcaccgcaaattc
tacgatgtgtaccgcaagcatggtgtcaaggatgaagaactcgagggtgtcgcagttcca
gactactctgaattcgtcgaatcgatggaagactctgaattcatgcaccgtggagtaaga
tgtgaaggcggtgggtacacgtttgctgatgccaattcgtcatcggcgttcaacgatctg
ctggatcatcttgccgctctcttcagtgcctcatacgacatcgatcgtaatgagttccag
agattcgacaaggaacgaatcttcaaaatgaaggcgagacgcttcgagctcgagtacgca
tcggctgatagatgtcaacgaggatacgaagaatgtgtccaattggacaacgctatcatc
gcgtatcacgagagagaagaacagcgtctgagagaaattcacatgcacgagggaagcaag
atgctgtggctggccgcttggtttaaaacaaaccggcagcaacacggtgagcatgcaaaa
ttcgatatgtctaaaatgattgctgaacggtacgaaccattaacctccctgacgattggc
aaatggtacagactctccgatgaaatggatgtcgcgattattttgtatattacatatttg
ctcaccccaacaccaggaaacactcaaaccggtcccccctattttcaatcattaaaacga
aacaatacgagtgctcaatatcggtttcaacaagaataa

DBGET integrated database retrieval system