KEGG   Caenorhabditis briggsae: CBG16328Help
Entry
CBG16328          CDS       T01054                                 

Gene name
Cbr-hda-4
Definition
(RefSeq) C. briggsae CBR-HDA-4 protein
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
cbr  Caenorhabditis briggsae
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cbr03036]
    CBG16328 (Cbr-hda-4)
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CBG16328 (Cbr-hda-4)
Chromosome and associated proteins [BR:cbr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     CBG16328 (Cbr-hda-4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 8585593
NCBI-ProteinID: XP_002643599
WormBase: CBG16328
UniProt: Q613L4
LinkDB All DBs
Position
X
AA seq 892 aa AA seqDB search
MAFFSSSSSSFPVVFARMEEASSSTGSTGGAMAGIPVIPSTSAALLANTNLEPERIAVLQ
TQLQEYRQKQMDLIGHFQRAQQELSVQHMHNLYTALQQQQQLQSLQERSGINPMLISQTS
EDATSGPAAPLSLANSLTNLLSSSNGNLSNLSVPQTPTKEHHPTLPPQQPSAPTSSRKSD
LPRTNSTTISQLTKDRLKNMIANRSKGESNSQSNLMSNVNGHDNSRRLKNSNSQMNVSSP
HFEPYRLPTSLANAHNLQQASEFQLRKVNSEPNLKMKIRAKLLSKGNSPVQHVQQTNNSQ
FSFTHPQLKRSDSETSNMPIDMLPSGSHSNIPHLMLPSPSLPNLAAATGAFQNLNLPIGQ
DLTAFMAVANLSPFLSLPSLLNKKLELGGMTDEGDRNGFSSSASNSSLASNASLGSHQYQ
SLLKQQIRDLVLRRKSLVREDPEGEGMAESYNGLFSHAKLQQLTALAMESGFNPKLEPTF
STGLGYDPLMARHECVCSNNSNHVENGERIQRIWSKLTEEGHVAKCERITAKKASLEQLQ
MVHSQTYTTFFAVSPTACLKIDANALPLKRFLQLPCGGIGIDSDTYFNDASTQIAARLAA
GTLIELSSQVAEGRLKNGFACIRPPGHHAEAEQALGFCFFNNVAVTAKVLQAKYPVQCAK
IAIIDWDVHHGNGTQLSFDDDPNVLYMSLHRHDNGNFFPGTGSVTEIGKGAGKGFSVNIP
FSGGVMKDAEYLAAWRTVVEPVLASFCPDFILVSAGFDACHGHVNALGGYEITPEMFGYM
TKCLLSYANGKVVLALEGGYNLDSISAAAEQCVQALIGESDDAGRLCTDSLENLPNQSAL
ETLQKVIAIHKGFWPALHGQEAAINTTEMQWRNVKLQVQMQQQQQLQQQLQQ
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggccttcttctcctcatcatcatcttcattcccggtcgtttttgcacgtatggaagaa
gccagctcctcaacggggagcactggcggagcaatggctggaattccggttataccatcg
acatcggccgcgcttttagcgaacacaaatttggaaccggaacggatcgcggtgctgcag
acacagcttcaggagtatcggcagaagcaaatggacctcataggtcactttcaacgcgct
cagcaggagctgagcgttcaacacatgcacaatctctacacggcactacaacaacaacag
cagctgcagagtttgcaagagagaagcggaatcaatccaatgttaatcagtcagacgtcg
gaggatgcaacctctggaccagcggcacctctctcacttgcaaattctctcaccaaccta
ctctcttcctcaaatggcaatctctctaatctatccgtaccacagacaccaacaaaagag
caccatccgacactgccgccacagcagccgtcggcgccaacttcaagccgaaaatctgac
ctcccacggacaaactccacaacgatatcgcagctcactaaagaccgcttgaaaaacatg
attgccaacaggagcaagggagagagcaatagtcaaagcaatctgatgtctaatgtaaat
ggacatgacaactcaaggaggctcaaaaactccaactcacagatgaacgtgtcttcacca
cactttgagccataccggttgccaacaagtctggcaaacgctcacaacttacaacaggcc
agcgagttccagctcaggaaggtgaattcggaaccaaacttgaagatgaaaatcagagcg
aaactattgtctaaaggaaatagcccagttcagcatgtacagcagacgaacaactcgcag
tttagtttcacacatccacaattgaaaagaagtgatagcgagacgtctaatatgcctatc
gacatgctgccgtctggctcacatagcaatattccacatcttatgcttccatcaccatcg
ctacccaacctcgctgccgctacaggagcgttccagaatttgaacttgccgattggacaa
gatctcactgctttcatggccgtcgccaacctcagcccattcctcagtcttccaagttta
ctgaataaaaagctggaactgggtgggatgacggatgaaggagaccggaacgggttttca
agctccgcctccaactcatctctcgcttctaatgcaagcctaggatctcaccagtatcag
tctcttctgaaacaacaaatccgtgatctggtccttaggcggaaaagtctcgtgcgtgaa
gacccagaaggagaaggcatggcagaatcttacaacggtctcttctctcatgctaaactt
caacaactcacagcgcttgccatggagtccggtttcaatccaaagctagaaccaactttt
tcaactggtcttggatacgatccactaatggctcgacacgagtgtgtctgcagcaacaat
agcaatcacgtggagaatggagagaggattcaacgaatctggtcgaagcttactgaagaa
ggacatgttgccaaatgcgagagaatcacggcgaaaaaagcttctttggagcaacttcag
atggttcactctcaaacctacacgactttcttcgcagtttctcctaccgcttgcctgaaa
attgatgccaacgcgttgccgttgaaacgattccttcagcttccatgtggaggcatcggc
attgactcggacacctattttaatgacgccagcactcagattgctgctcgtttagccgct
ggaacattgattgaactgtcttcacaggttgccgagggacgtttaaagaacggattcgct
tgcatccgaccgccaggtcaccatgctgaagctgaacaagcactaggattctgtttcttt
aacaacgtggctgtcactgctaaggttcttcaagccaagtatccggttcaatgcgccaag
atcgctatcattgattgggacgtccaccacggaaatggaacgcagttgagttttgacgac
gacccgaatgtgctctacatgtctcttcaccgtcacgataatggaaacttcttccctggc
accggatctgtcactgaaattggaaagggggctggaaaaggtttttcagtgaacatcccc
ttctccggaggcgtcatgaaggatgccgagtaccttgccgcatggagaactgtcgtggaa
ccagtgctggctagcttctgtccagacttcatcttagtctccgctggcttcgacgcttgt
catggacatgtgaacgctctcggaggttatgaaatcactccagagatgtttggatacatg
accaagtgtcttttgagctatgccaatggaaaggtggtcctggcactcgaaggaggatac
aatttagatagcatttctgctgctgctgagcagtgtgtgcaggctctaatcggcgaatct
gacgatgctggtcgcttgtgcacggattcgttggagaacttgccgaatcaaagcgcactg
gagacactacaaaaggttattgctattcataaaggcttctggcctgcattgcacggacaa
gaagctgcaattaacacaacggaaatgcaatggagaaatgtgaaactgcaagtgcaaatg
cagcagcagcaacaacttcaacagcagctccaacaataa

DBGET integrated database retrieval system