KEGG   Caenorhabditis briggsae: CBG19814Help
Entry
CBG19814          CDS       T01054                                 

Gene name
Cbr-kin-1
Definition
(RefSeq) C. briggsae CBR-KIN-1 protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr04010  MAPK signaling pathway
cbr04020  Calcium signaling pathway
cbr04140  Autophagy - animal
cbr04213  Longevity regulating pathway - multiple species
cbr04310  Wnt signaling pathway
cbr04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CBG19814 (Cbr-kin-1)
   04310 Wnt signaling pathway
    CBG19814 (Cbr-kin-1)
   04020 Calcium signaling pathway
    CBG19814 (Cbr-kin-1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CBG19814 (Cbr-kin-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CBG19814 (Cbr-kin-1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    CBG19814 (Cbr-kin-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cbr01001]
    CBG19814 (Cbr-kin-1)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cbr03019]
    CBG19814 (Cbr-kin-1)
   03036 Chromosome and associated proteins [BR:cbr03036]
    CBG19814 (Cbr-kin-1)
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CBG19814 (Cbr-kin-1)
Protein kinases [BR:cbr01001]
 Serine/threonine kinases: AGC group
  PKA family
   CBG19814 (Cbr-kin-1)
Messenger RNA biogenesis [BR:cbr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CBG19814 (Cbr-kin-1)
Chromosome and associated proteins [BR:cbr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    CBG19814 (Cbr-kin-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase POR
Motif
Other DBs
NCBI-GeneID: 8582736
NCBI-ProteinID: XP_002640742
WormBase: CBG19814
UniProt: A8XW88
LinkDB All DBs
Position
I
AA seq 374 aa AA seqDB search
MLKFLKPKSSDEGSSKDNKSAASLKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTLGT
GSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFK
DNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPEN
LLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEM
AAGYPPFFADQPIQIEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIK
NHKWFGSTDWIAIYQRKIKPPSFSNGEPKGRLFEALYARVDGPADTRHFVEEVQEPTQFV
IASTCQLPELFEDF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagtttttaaagcccaaatcgtcagatgagggcagttcgaaggacaacaaatcg
gcggcgtcgctcaaagagttcctggacaaagcacgagaggacttcaaacaacgatgggag
aatccggctcagaacacggcgtgtctcgacgacttcgatcggataaaaacgctgggaacc
ggctcgtttggtcgtgtgatgcttgtcaaacataagcagtcgggcaactattatgccatg
aaaattctcgacaaacaaaaggtagtaaaacttaaacaagtggagcacacgctgaacgag
aagcgcatccttcaagccatcgattttccattcttggtcaacatgacattctcgttcaag
gacaactcaaatctgtacatggtattggaattcatctcgggaggagaaatgttctcccat
cttcgccgaatcggacgcttctcggaacctcattctcgcttctacgctgctcaaatcgtg
ttggcattcgagtacttgcactcgttggatctcatctatcgtgatttgaagccagagaat
ttgctcatcgactcgactggatatttgaagatcaccgactttggattcgcgaaacgcgtc
aaggggcgaacgtggacgttgtgcggaactccagaatacttggcaccggagattatcctt
tccaaaggatacaacaaggctgttgattggtgggcacttggcgtgttgatctacgaaatg
gctgccggatacccaccattcttcgccgatcaaccaattcagatcgagaaaatcgtgtca
ggaaaggtcaaattcccatctcacttctcaaacgagctcaaagacttgctcaagaacctg
ctccaagtggatttgacgaaacggtacggaaatctaaagaacggagtggccgacatcaaa
aatcacaaatggttcggatctaccgactggattgccatctatcagcgaaagatcaaaccg
ccctcattctccaacggagaacccaagggacggctattcgaagcgctgtatgcacgtgtc
gatggtccagctgacactcgacactttgtggaagaagttcaggaaccaacgcaattcgtg
atcgcatcgacgtgtcagctgccggagctgtttgaggatttctag

DBGET integrated database retrieval system