KEGG   Caenorhabditis briggsae: CBG21724Help
Entry
CBG21724          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG21724
  KO
K15111  solute carrier family 25 (mitochondrial S-adenosylmethionine transporter), member 26
Organism
cbr  Caenorhabditis briggsae
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cbr02000]
    CBG21724
Transporters [BR:cbr02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   CBG21724
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr Serine_protease
Motif
Other DBs
NCBI-GeneID: 8574962
NCBI-ProteinID: XP_002632966
WormBase: CBG21724
LinkDB All DBs
Position
IV
AA seq 266 aa AA seqDB search
DKGSVVRWLVCGATAGLAVDIGLYPLDTIKSRMQSKQGFIAAGGFKDVYRGMSSVLVGSA
PGAAIFFLTYKYINGQMKRIIKGRDALVDAVSASLAEIAACAVRVPTELCKQRGQVNKGT
RLTLICKEIMETKGLKGFYQGYGSTVAREIPFSIIQFPIWEALKRKVAENKESGRCSPLE
GAACGSVAGCIAAGLTTPLDVAKTRIMLTKTGPAPGILSTLKEVYTTGGMGGLYSGVVPR
VMWISGGGFVFFGAYETAMHFTKFLD
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gataaaggatcggtggttcgatggttggtgtgtggagcgacggctggattggctgtggat
attggattgtatccattggataccatcaaatccagaatgcaatcgaaacagggttttatt
gcggctggagggtttaaagacgtttatagaggaatgagctcggtattagttggctcagca
ccgggcgccgccatcttcttcctcacctacaaatacatcaacggacaaatgaaacgaatc
atcaagggacgagacgcactagtcgacgcagtttcagcgagtttggctgaaatcgccgcg
tgcgccgtccgtgtcccaacggaattgtgtaagcagagaggacaagtgaacaagggaaca
cggctgacgttgatttgtaaagaaattatggagacgaaagggttgaaagggttctatcaa
ggatatgggagtacggtagccagggagattccattctcgattattcagtttccgatatgg
gaagcgttgaagaggaaggtggctgagaataaagaatccggtcgatgtagtccgttggaa
ggagccgcctgtggaagtgtagctggatgtattgcagctggattgactacacctctcgac
gtggcaaaaacaagaatcatgcttacgaaaaccggtccagctcctggtattttaagcaca
ttaaaagaggtctacacaactggcgggatgggcggtctctactcgggcgtcgtgccacgt
gtcatgtggatctctggcggcggattcgtcttctttggtgcttatgaaacggcgatgcat
tttaccaaatttttagattag

DBGET integrated database retrieval system