KEGG   Caenorhabditis briggsae: CBG22795Help
Entry
CBG22795          CDS       T01054                                 

Gene name
Cbr-sdha-1
Definition
(RefSeq) C. briggsae CBR-SDHA-1 protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00020  Citrate cycle (TCA cycle)
cbr00190  Oxidative phosphorylation
cbr01100  Metabolic pathways
cbr01200  Carbon metabolism
Module
cbr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cbr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CBG22795 (Cbr-sdha-1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CBG22795 (Cbr-sdha-1)
Enzymes [BR:cbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CBG22795 (Cbr-sdha-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 8587528
NCBI-ProteinID: XP_002645529
WormBase: CBG22795
UniProt: A8Y2W5
LinkDB All DBs
Position
X
AA seq 645 aa AA seqDB search
MLRAASNGLRNAVAARSVSLSAANYSEKRSDIAQYKVVDHAYDAVVVGAGGAGLRAAMGL
SEGGLKTAVITKLFPTRSHTVAAQGGINAALGNMNPDNWRWHFYDTVKGSDWLGDQDAIH
YMTREAERAVIELENYGMPFSRTTDGKIYQRAFGGQSNDFGRGGQAHRTCCVADRTGHSL
LHTLYGASLQYNCNYFVEYFALDLIMENGTCVGVIAMDLEDGTIHRFRSKNTVLATGGYG
RAFFSCTSAHTCTGDGTALTARAGINNSDMEFVQFHPTGIYGAGCLITEGSRGEGGYLVN
SAGERFMERYAPVAKDLASRDVVSRSMTIEIMEGRGVGPDKDHIYLQLHHLPAEQLQQRL
PGISETAMIFAGVDVTKEPIPVIPTVHYNMGGVPTNYKGQVLNYSSEKGDEVVPGLYAAG
ECGAHSVHGANRLGANSLLDLVIFGRACAIDILKNTSAGVGVPDLPKNAGEASVANLDKL
RHNNGDISTAELRLTMQKAMQKHAAVFRRGDILQEGVKVLSKLYKDQAHLKVADKGLVWN
SDLIETLELQNLLINATQTIVAAENRKESRGAHARDDFPDRLDELDYSKPLEGQTKKEFK
DHWRKHSIIRSNIETGDVSLDYRPVIDTTLDKSETDWVPPKVRSY
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgctacgcgccgccagcaacggcctccgcaatgcggttgccgcccgctccgtgtcgcta
tccgctgctaattacagcgagaaacgatccgacattgcccagtacaaggtcgtcgaccac
gcctatgacgcagtcgtcgtcggagccggaggagctggtcttcgtgccgctatgggactt
tccgagggaggactcaagaccgccgtcatcaccaagctattcccaaccagatctcacaca
gttgctgctcaaggaggaatcaacgctgccctcggaaacatgaacccagataactggcgc
tggcatttctacgacactgtcaagggatccgattggctcggagaccaagatgccatccac
tacatgactcgtgaggccgaaagagctgtcatcgagcttgagaactatggaatgccattc
tcccgtacaactgacggaaagatctaccaacgtgccttcggaggacaatccaacgacttt
ggacgtggaggacaggctcacagaacctgctgtgttgctgatcgtactggacactctctt
ctccacaccctctatggagcttcccttcaatacaactgcaactactttgtcgagtacttc
gctctcgacctcattatggagaacggaacttgcgtcggagtcatcgccatggatcttgag
gacggaaccatccatcgtttccgctcgaagaacaccgttcttgccaccggaggatacgga
agagccttcttctcctgcacatctgcccacacttgcactggagacggaactgctcttacc
gctagagctggaatcaacaactccgacatggagtttgttcaattccacccaactggaatc
tacggagctggatgcttgatcactgaaggatctcgtggagaaggaggatacttggtcaac
tccgctggagaacgtttcatggagcgttatgccccagttgctaaggatcttgcctcccgt
gacgttgtatctcgttccatgactatcgaaatcatggagggacgtggagtcggaccagac
aaggaccacatctaccttcaacttcaccatctcccagccgagcaactccaacagagactt
ccaggaatttccgagaccgctatgatcttcgctggagtcgatgttactaaggagccaatt
ccagttatcccaactgtccactacaacatgggaggagttccaaccaactacaagggacaa
gttctcaactattcctctgaaaagggagatgaagttgtgccaggactctacgccgctgga
gaatgtggagctcactccgtccacggagccaacagacttggagctaactctcttcttgat
ttggttatcttcggaagagcttgcgctattgacattctcaagaacacttccgccggagtt
ggagtcccagaccttccaaagaacgccggagaagcctccgtcgccaatctcgacaaactt
cgccacaacaacggagacatctccaccgcagagcttcgtctcaccatgcaaaaggccatg
caaaagcacgccgccgtcttccgtcgtggagatatccttcaggaaggagtcaaggtcttg
tccaaactttacaaggaccaagcccatctcaaggttgccgacaagggactcgtctggaac
tctgacctcatcgagacccttgagcttcagaatctcctcatcaacgccacccaaaccatt
gtcgctgctgagaacagaaaggaatcccgtggagctcacgctcgtgacgacttcccagac
cgccttgacgagttggactacagcaaaccattggaaggacaaaccaagaaggagttcaag
gatcactggcgcaagcactcgatcatcagatccaacatcgaaactggagacgtctccctc
gactaccgtccagtcatcgataccaccctcgacaagagcgagaccgactgggtgccacca
aaggtccgctcctattaa

DBGET integrated database retrieval system