KEGG   Caenorhabditis briggsae: CBG24606
Entry
CBG24606          CDS       T01054                                 

Gene name
Cbr-ced-9
Definition
(RefSeq) C. briggsae CBR-CED-9 protein
  KO
K20094  cell death protein 9
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    CBG24606 (Cbr-ced-9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cbr02000]
    CBG24606 (Cbr-ced-9)
Transporters [BR:cbr02000]
 Other transporters
  Pores ion channels [TC:1]
   CBG24606 (Cbr-ced-9)
SSDB
Motif
Pfam: Bcl-2 BH4
Other DBs
NCBI-GeneID: 8583298
NCBI-ProteinID: XP_002641306
WormBase: CBG24606
UniProt: P41957
LinkDB
Position
III
AA seq 266 aa
MVDSMDMANSSQNTFRRRTMATSEMREFLSTKDAEPNNFGMQTIPESPTPSTPTRRMSIG
DSTRIYDWEEPRFNIQGFVVDYFTYRIAQNGLDWYDAPALPDGVQKEHEMMRSLGTIFEK
RHMEMFENFSEQLLAVPKISFSLYQEVVQTVGNSSNTPCPMSYGRLIGLISFGGMVAAKM
MESAELQGQVRNLLMYTSLFIKTRIRQSWKEHNRSWADFMKLGQQMKEDYEKEKDAEEGK
RLKSWSIIGASVIAVIVCGRIIFSFK
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtcgattcgatggatatggcaaactcgtcgcagaatacgttccgacggaggacaatg
gccacaagtgaaatgagagagttcttatcaacaaaagacgcagagccgaacaacttcgga
atgcagactataccagaatcaccgactcctagcacaccaactagaaggatgtcaattgga
gattcaaccagaatttatgattgggaagaacctcggttcaacattcagggatttgttgtt
gactatttcacatatcgcatagcacaaaatggtctagattggtatgatgcgcctgcatta
cccgatggagttcaaaaagagcatgagatgatgcgatcattgggaacgattttcgaaaaa
agacacatggagatgttcgaaaacttctctgaacaactacttgcagttccaaaaataagt
ttttcattgtaccaagaagtggtgcagactgttggaaattcatcaaacacaccgtgtcca
atgtcttacggacgtttgataggtctaatttccttcggaggaatggttgctgccaaaatg
atggagtctgctgagctacaagggcaagtgcgaaaccttcttatgtacacatcgctgttc
atcaaaacgagaatccgacagtcgtggaaagaacacaatcgtagctgggcggatttcatg
aagctcggacaacaaatgaaagaagactacgaaaaagaaaaggacgctgaagaagggaaa
cggctcaagagttggtccatcatcggagccagcgtcatcgcagtgattgtgtgtggtcgg
ataatattcagcttcaagtag

DBGET integrated database retrieval system