KEGG   Citrobacter braakii: A6J81_02905Help
Entry
A6J81_02905       CDS       T04825                                 

Definition
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
cbra  Citrobacter braakii
Pathway
cbra00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cbra01100  Metabolic pathways
cbra01110  Biosynthesis of secondary metabolites
cbra01130  Biosynthesis of antibiotics
cbra01230  Biosynthesis of amino acids
cbra02024  Quorum sensing
Module
cbra_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cbra00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A6J81_02905
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A6J81_02905
Enzymes [BR:cbra01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     A6J81_02905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: ARC39752
LinkDB All DBs
Position
complement(565977..567023)
Genome map
AA seq 348 aa AA seqDB search
MNRTDELRTARIDNLVTPAELAQRHPVSSSVARHVTESRRRIEKILNGEDARLLVIVGPC
SIHDLDAAMEYATRLQGLREKHQARLEIVMRTYFEKPRTVVGWKGLISDPDLNGSYRVNH
GIELARKLLLQVNELGVPTATEFLDMVTGQFIADLISWGAIGARTTESQIHREMASALSC
PVGFKNGTDGNTRIAVDAIRASRASHMFLSPDKTGQMTIYQTSGNPYGHIIMRGGKKPNY
YAEDIAAACDTLHEFSLPEHLVVDFSHGNCQKQHRRQLDVCDDVCQQIRNGSTAIAGIMA
ESFLREGTQKIVSGQPLVYGQSITDPCLNWEDTELLVEKLASAVDSRF
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaaccgatgaactccgtactgcgcgtattgacaatctggtcactccagcagag
cttgcgcaacggcatcctgtttcttcctccgtcgcccgtcatgtcacggaatcccgacgt
cggatagaaaaaatattaaatggtgaagacgctcgtttgctggtgatcgtaggtccctgc
tcgattcacgatcttgatgccgccatggaatacgcgacccgcttgcaggggctacgcgaa
aaacatcaggcgcgcctggaaatcgtgatgcgcacctattttgaaaaaccgcgcaccgtc
gtgggctggaaaggcttaatttccgacccggatttaaacggcagctaccgcgtgaaccac
ggcattgaactggcgcgcaagctgctgttgcaggtcaatgaactgggcgtacccacggca
acagaattcctcgacatggtgaccggtcagtttattgccgatttaatcagttggggagcc
attggcgcgcgcaccaccgaaagccaaatccaccgtgaaatggcgtccgcgctctcctgt
ccggtcggctttaaaaacggcacggatggcaacacgcgtatcgctgtcgatgcgatccgc
gcctcccgcgccagccacatgttcctctctccggataaaaccggccagatgaccatttat
caaaccagcggtaatccttacggacatatcattatgcgcggcggtaaaaagccgaattat
tatgctgaagatattgccgccgcctgcgataccctgcacgaattttccctgcctgagcat
ctggtagtcgattttagccacggcaattgccagaagcagcatcgtcgtcagttggacgtt
tgtgatgacgtgtgtcagcaaattcgcaacggttcgacggcgattgccgggattatggcg
gagagtttcctgcgtgaaggtacgcaaaaaatcgttagcggccagccgctggtttacggt
cagtccattaccgacccatgcctgaactgggaagatactgaactgctggttgaaaaactc
gcctctgcggttgatagccgtttttaa

DBGET integrated database retrieval system