KEGG   Citrobacter braakii: A6J81_11345Help
Entry
A6J81_11345       CDS       T04825                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
cbra  Citrobacter braakii
Pathway
cbra00730  Thiamine metabolism
cbra00790  Folate biosynthesis
cbra01100  Metabolic pathways
cbra02020  Two-component system
Module
cbra_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cbra00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    A6J81_11345
   00790 Folate biosynthesis
    A6J81_11345
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A6J81_11345
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbra04147]
    A6J81_11345
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cbra00537]
    A6J81_11345
Enzymes [BR:cbra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     A6J81_11345
Exosome [BR:cbra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A6J81_11345
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cbra00537]
 Enzymes
  A6J81_11345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase
Motif
Other DBs
NCBI-ProteinID: ARC41266
LinkDB All DBs
Position
complement(2294169..2295584)
Genome map
AA seq 471 aa AA seqDB search
MKQSALAIALIPLLFTPVINAETSTVAVMDNRAAQGDITTPGGARRLSADQTAALRESLN
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALDKKTGKPDY
VTDSAASATAWTTGVKTYNGALGVDIHEKDHATILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPDVTREKCPTNALEKGGKGSITEQLLNARADVTLGGGAKTFAETAAAG
EWQGKTLREQALARGYRMVSDAATLAAITEANQDKPLLGLFSDGNMPVRWEGPKASYHGN
LDKPVVTCTPNPKRDDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALAFAKKDGNTLVVVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VISYGNSEEESQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcgcactcgctattgccctgatacctttgctgtttaccccagttattaat
gcagaaacttctaccgtagcggttatggataatcgtgccgctcagggtgatatcaccacg
ccgggcggcgcccgtcgattgtcagccgatcaaactgcggctctgcgcgaatctctgaac
gataaacctgccaaaaatattattttactgattggcgatggtatgggggactcagaaatt
actgcagcgcgaaattatgccgaaggcgcgggcggcttttttaaaggtattgatgcttta
ccattgaccggacaatacacgcactatgcgctggataaaaaaacgggtaaacccgattat
gtgacggattctgcggcatccgcaacggcgtggaccaccggcgtgaaaacctataacggt
gctctgggcgttgatatacatgaaaaagatcacgctacaattcttgaaatggcaaaagcg
gcgggtctggcgacaggcaacgtttctaccgctgaattgcaggatgctaccccggcggcg
ctggttgctcatgtgacctcgcgtaagtgctatggtcccgacgtgacccgtgaaaaatgc
ccaaccaatgcgctggaaaaaggcggcaaaggatccatcaccgaacaattactgaatgcc
cgggctgacgttacgctgggcggcggggccaaaacgtttgcggaaaccgctgcggcaggt
gagtggcagggtaaaacgttgcgtgaacaagcccttgcccgcggttatcggatggtgagc
gatgccgcgacgctggcagcgattaccgaagctaatcaggataaaccgttgctgggtctg
ttctctgacggcaatatgccggtacgctgggaagggccgaaagcgtcttatcacggcaat
ctggataaaccggtagtgacctgtacccccaatccaaagcgtgacgacagcgtgccaacg
ctggcgcagatgacggataaagcgattgagctgttaagcaaaaatgagaaaggtttcttc
ctgcaagtggaaggggcgtcaatcgataaacaggaccacgccgccaacccgtgcggacag
attggcgaaacggtcgatctggatgaagcggtacagcgcgcgcttgcttttgcgaagaaa
gatggcaataccctggtggtagtaaccgctgaccacgcgcatgccagccagatagtcgcg
ccggatactaaagcgccaggcctgactcaggcgctgaacaccaaagatggcgcggtcatg
gttatcagctacggcaactctgaagaggaatcccaggagcataccggcagccagctgcga
attgcagcctatggcccgcacgcggcgaatgtggttggtctgaccgatcaaaccgacctg
ttttacaccatgaaagcggcgttaggactgaaataa

DBGET integrated database retrieval system