KEGG   Citrobacter braakii: A6J81_11360Help
Entry
A6J81_11360       CDS       T04825                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cbra  Citrobacter braakii
Pathway
cbra00473  D-Alanine metabolism
cbra00550  Peptidoglycan biosynthesis
cbra01100  Metabolic pathways
cbra01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cbra00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A6J81_11360
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A6J81_11360
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A6J81_11360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbra01011]
    A6J81_11360
Enzymes [BR:cbra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A6J81_11360
Peptidoglycan biosynthesis and degradation proteins [BR:cbra01011]
 Precursor biosynthesis
  Amino acid ligase
   A6J81_11360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATPgrasp_ST CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: ARC43816
LinkDB All DBs
Position
2297678..2298772
Genome map
AA seq 364 aa AA seqDB search
MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGIDKQGQWHVSDASNYLLN
SDDPAHIALRPSATSLAQVPGKQAHQLIDAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLGSAACMDKDVTKRLLRDAGLNIAPFITLTRANRNSISFAEVESRLGL
PLFVKPANQGSSVGVSKVTSEAQYEQAVALAFEFDHKVVVEQGIKGREIECAVLGNDHPQ
ASTCGEIVLNSDFYAYDTKYIDDNGAKVVVPAAIAPEINDKIRDIAIQAYQTLGCAGMAR
VDVFLTAENEVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIELALERHAADSAL
KTSM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagttgcgggtaggaatcgtatttggtggtaaatcagcggaacatgaagtgtca
ttgcaatcggcaaaaaatattgtcgatgccatcgacaagactcgctttgacgttgtgctg
ttaggtattgataaacaagggcaatggcacgtcagcgatgccagtaactatctgcttaat
tcagacgatccggcgcatatagcgctgcgtccttccgcgaccagcctggctcaggtaccg
ggtaaacaagcgcaccagttgatcgatgcgcaaaacggtcagccgctgccaacggttgat
gttattttcccgatcgttcacggcacgctgggtgaagatggctctctgcagggcatgctg
cgggtggcgaatctgccgttcgtcggttctgatgtcctggggtctgcggcctgtatggat
aaagacgtgaccaaacgtctgttgcgcgatgccggattaaacatcgcgccatttattacg
ctcactcgcgccaatcgcaacagcatcagctttgccgaagtcgaatctcgcctcggtttg
ccgctgtttgtgaaaccagccaatcagggatcgtccgttggggtcagtaaggtgaccagc
gaagcgcaatatgaacaggccgtcgcgctggcatttgaatttgatcataaagtcgtggtg
gagcaagggatcaaaggccgcgagatcgaatgcgcggtgctgggcaacgatcatccgcag
gccagtacctgtggcgagatcgtgctgaacagtgatttttacgcttacgacaccaaatac
attgacgataacggtgccaaagtggtggttccggcagcgatcgcaccggaaattaacgat
aagatccgtgatattgctattcaggcctatcaaacgctgggctgcgccggcatggcgcgc
gtggacgtgttcttaaccgcagagaacgaggttgtgatcaatgagatcaacacgctgcct
ggctttaccaacatcagcatgtatccaaaactgtggcaggcgagcggcttaggctatacc
gatttgatcactcgcctgatcgaactggcgctggaacgccatgcggcggatagcgcgctg
aaaaccagtatgtaa

DBGET integrated database retrieval system