KEGG   Citrobacter braakii: A6J81_16845
Entry
A6J81_16845       CDS       T04825                                 

Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
cbra  Citrobacter braakii
Pathway
cbra00521  Streptomycin biosynthesis
cbra00523  Polyketide sugar unit biosynthesis
cbra00525  Acarbose and validamycin biosynthesis
cbra01100  Metabolic pathways
cbra01110  Biosynthesis of secondary metabolites
Module
cbra_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:cbra00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    A6J81_16845
   01055 Biosynthesis of vancomycin group antibiotics
    A6J81_16845
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A6J81_16845
   00525 Acarbose and validamycin biosynthesis
    A6J81_16845
Enzymes [BR:cbra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     A6J81_16845
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 3Beta_HSD RmlD_sub_bind NAD_binding_4 adh_short Sacchrp_dh_NADP KR
Other DBs
NCBI-ProteinID: ARC42253
LinkDB
Position
complement(3461316..3462383)
AA seq 355 aa
MKRILVTGGAGFIGSAVVRHIIHDTEDAVVVVDKLTYAGNLMSLEPVAQNSRFAFEKVDI
CDRVSLDRVFQHYQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNGLA
SEKKLAFRFHHISTDEVYGDLHSIDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGL
PTLITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVA
TAGVVGETYNIGGHNERKNLDVVETVCSLLEELAPHKPQGIAQYRDLIAFVDDRPGHDLR
YAIDASKIARELGWMPQETFESGMRKTVQWYLDNQAWWKPVQDGSYQGERLGLKG
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgaaacgaattcttgttactggcggagcgggatttatcggctcggcggttgtgcggcat
atcattcatgataccgaggatgcagtggttgtggtcgataagctgacctacgccggaaac
ctgatgtcgctggagccagttgcgcagaattcccgttttgcctttgagaaagtggatatt
tgcgatcgggtatcgctcgacagggtgtttcaacactatcagccggactgcgtgatgcat
ctggctgctgaaagccatgtcgatcgctcaatcgacggtccggctgcctttatcgaaacc
aacattgtgggaacctacacgctgttggaagcggcgcgcgcttactggaatggattggcc
agcgagaaaaaattggcgtttcgtttccaccatatttcgactgacgaggtgtatggcgat
ctccattccatagatgatttcttcaccgaaaccacgccgtatgcgccaagcagcccttat
tccgcctcgaaagccagcagcgatcatcttgtccgcgcctggctgcgtacctacggtctg
ccaacgctgattaccaattgttccaacaactatggtccgtaccatttcccggaaaaactg
attccgctaatgatcctcaacgcactggcggggaaaccgttgccggtgtacggcaatggt
caacagatccgtgactggttgtatgtagaagatcacgcgagggcgctctattgcgtggcg
acggcgggcgtggttggagaaacctataatattggtggtcataacgagcgtaaaaacctg
gatgtcgtcgaaacagtttgcagcctgctggaagagctggcgccgcataaaccgcagggc
attgcacagtaccgcgatttgatcgcttttgtggacgatcgccctggccatgatttgcgt
tacgccattgacgcttcaaaaattgcgcgtgaactaggttggatgccgcaggaaacgttt
gaaagcggaatgcgcaaaaccgtgcagtggtatctggataatcaggcatggtggaaaccc
gtgcaggacggcagttaccagggcgaacgtttaggtctgaagggctaa

DBGET integrated database retrieval system