KEGG   Citrobacter braakii: A6J81_17180Help
Entry
A6J81_17180       CDS       T04825                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein PstB
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
cbra  Citrobacter braakii
Pathway
cbra02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cbra00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    A6J81_17180
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cbra02000]
    A6J81_17180
Enzymes [BR:cbra01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     A6J81_17180
Transporters [BR:cbra02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    A6J81_17180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_22 AAA_29 RsgA_GTPase AAA_16 Rad17 AAA_23 PRK AAA_30 AAA_33 AAA_24 G-alpha PhoH AAA_25 RNA_helicase ATPase_2 Adeno_IVa2 AAA_5 Mg_chelatase TniB AAA_28 AAA_18 APS_kinase
Motif
Other DBs
NCBI-ProteinID: ARC43856
LinkDB All DBs
Position
3530616..3531389
Genome map
AA seq 257 aa AA seqDB search
MSMVDTAPGKIQVRDLNFYYGKFHALKNINLDIAKNQVTAFIGPSGCGKSTLLRTFNKMF
ELYPEQRAEGEILLDGDNILTNTQDIALLRAKVGMVFQKPTPFPMSIYDNIAFGVRLFEK
LSRADMDERVQWALTKAALWNETKDKLHQSGYSLSGGQQQRLCIARGIAIRPEVLLLDEP
CSALDPISTGRIEELITELKQDYTVVIVTHNMQQAARCSDHTAFMYLGELIEFSNTDDLF
TKPAKKQTEDYITGRYG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggttgatactgccccgggtaagattcaggttcgtgatttgaacttctactat
ggcaaattccatgccctgaagaacatcaacctggatattgctaaaaaccaggtaacggcg
tttatcgggccgtcaggctgtggtaaatcgacgctgctgcgtacattcaacaaaatgttt
gaactgtacccggaacagcgtgcggaaggcgaaatcctgctggatggcgacaatattctc
actaacactcaggatatcgctctgctgcgtgccaaagtgggcatggtattccagaagccg
acgccgttcccgatgtccatctacgataacatcgcttttggggtgcgtctgtttgagaaa
ctctcgcgtgccgatatggacgaacgtgtgcagtgggcgttgaccaaggccgcactgtgg
aacgaaaccaaagataaattacaccagagcgggtactctctctccggtggtcagcagcag
cgtctgtgtattgcgcgcggtatcgccattcgtccggaagtgcttctgctggatgagcca
tgttcagcgctcgaccctatttctaccgggcgcattgaagagctgatcacagagctgaaa
caagattacaccgtcgttatcgtaacccacaacatgcagcaggctgcgcgttgttccgat
cacacggcgtttatgtacctgggcgagttgattgagttcagtaatacggacgatctgttc
accaagcccgcgaagaaacaaactgaagattacattactggccgctacggttga

DBGET integrated database retrieval system