KEGG   Coxiella burnetii RSA 331: COXBURSA331_A0630Help
Entry
COXBURSA331_A0630 CDS       T00632                                 

Gene name
aspC
Definition
(GenBank) aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
cbs00220  Arginine biosynthesis
cbs00250  Alanine, aspartate and glutamate metabolism
cbs00270  Cysteine and methionine metabolism
cbs00330  Arginine and proline metabolism
cbs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cbs00401  Novobiocin biosynthesis
cbs01100  Metabolic pathways
cbs01110  Biosynthesis of secondary metabolites
cbs01130  Biosynthesis of antibiotics
cbs01210  2-Oxocarboxylic acid metabolism
cbs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    COXBURSA331_A0630 (aspC)
   00270 Cysteine and methionine metabolism
    COXBURSA331_A0630 (aspC)
   00220 Arginine biosynthesis
    COXBURSA331_A0630 (aspC)
   00330 Arginine and proline metabolism
    COXBURSA331_A0630 (aspC)
   00350 Tyrosine metabolism
    COXBURSA331_A0630 (aspC)
   00360 Phenylalanine metabolism
    COXBURSA331_A0630 (aspC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    COXBURSA331_A0630 (aspC)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    COXBURSA331_A0630 (aspC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cbs01007]
    COXBURSA331_A0630 (aspC)
Enzymes [BR:cbs01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     COXBURSA331_A0630 (aspC)
Amino acid related enzymes [BR:cbs01007]
 Aminotransferase (transaminase)
  Class I
   COXBURSA331_A0630 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Aminotran_MocR DegT_DnrJ_EryC1 LTD
Motif
Other DBs
NCBI-ProteinID: ABX78062
LinkDB All DBs
Position
complement(537415..538599)
Genome map
AA seq 394 aa AA seqDB search
MNDVLSVRAQQLEPSVTLAVSDLARELLNKGHDVISLSAGEPDFDTPDFIKQSAIKAIQE
GFTKYTNVDGTPALKAAIVHKLKRDNHLNYEPSEILVSGGAKQSIYNVLMGTLNAGDEAI
IPAPYWVSYPPMVQLAEAKPIIISATIDQNFKLTPGQLSQAITPQSRLLILNSPNNPSGV
AYTESELKALADVLMEHPQILILSDEIYEYILWGQNRFVNILNVCPELRDRTIIINGASK
AYAMTGWRIGYAAGPKSIIQAMKKIQSQSTSSPNSIAQVAATTALGAQRGDFAYMYEAYK
TRHDLVLKALNQMKGVHCIPADGAFYLFPDVSAAIQQLGLEDDIKLGTYLLDKTKVAVVP
GSAFGSPGHVRLSCATSTEKLQEALERLASVLDY
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatgtcttatccgtccgagcgcaacaacttgaaccctcagtaacattggctgtc
tccgatctcgcacgcgagcttttaaacaagggccatgacgtgatcagtctcagcgcaggt
gaaccggattttgacaccccggactttatcaaacagtccgccattaaagcaattcaagaa
ggctttaccaaatacaccaatgtagacggaactcctgccctaaaagcggcgattgtccat
aaattaaagcgcgataatcacttaaactacgagccttctgaaatactggtcagcggcgga
gccaaacaatcgatctataacgtcctgatgggaacgctaaatgcgggggacgaagccatc
attcctgccccttattgggtgagctatccaccaatggtacaactggcggaagcaaaaccc
attattatctcagcgaccattgaccaaaattttaaactcactcccggtcagctctctcaa
gcgattactccccaatcgcgactgctgattttaaacagtcccaacaacccttccggagtt
gcttatactgaaagtgaattaaaagcgttggcagacgttttgatggagcatccccaaatt
ttaattctttccgatgaaatttatgaatatattctgtggggacaaaaccgttttgtaaat
atccttaacgtttgcccggaattgcgcgatcgcactatcattatcaacggcgcttccaag
gcttatgccatgaccggatggcgaattggttatgcggctggtcctaaatcgattattcaa
gcaatgaaaaaaattcaatctcagagtacttcttctcccaattcgattgcccaagtcgct
gccacgacagcactcggcgctcagcgcggtgattttgcttacatgtatgaggcttataaa
acacgccacgatttggtgctgaaagcccttaatcaaatgaaaggtgttcactgcattccc
gctgacggcgccttttacctcttccccgatgtttcggctgccatccaacagctcggatta
gaggatgacatcaaactcggaacgtacttattggataaaacgaaagttgccgtcgtcccc
ggaagcgcctttggctcgcccggacacgttcgcctttcttgtgcaaccagcaccgaaaaa
ttgcaagaagccctggagcggttagcgtcggtactggattattag

DBGET integrated database retrieval system