KEGG   Coxiella burnetii RSA 331: COXBURSA331_A1150Help
Entry
COXBURSA331_A1150 CDS       T00632                                 

Gene name
emrA
Definition
(GenBank) multidrug resistance protein A
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
cbs  Coxiella burnetii RSA 331
Brite
KEGG Orthology (KO) [BR:cbs00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cbs02000]
    COXBURSA331_A1150 (emrA)
Transporters [BR:cbs02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   COXBURSA331_A1150 (emrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_3 HlyD_D23 Biotin_lipoyl_2 HlyD Biotin_lipoyl HlyD_2 Ribosomal_S13_N Efg1 DUF2681
Motif
Other DBs
NCBI-ProteinID: ABX77762
LinkDB All DBs
Position
1032567..1033562
Genome map
AA seq 331 aa AA seqDB search
MIKKFVKVILPLFIIAILSIGGYFYWQHQNRYPSTDDAYIQADVINVASRVSGTVSEIDV
RNEEHVQKGQLLFTIDPAPFTIELNKAQAQRDATRQKIQAADMAVKSARATVVERKAELT
HTRLETKRILTLMKKQFVSRSDGDLAIKNLHVAEAALNAAQNQLEEMIEKRGELGDKNAQ
LRLAQAAVEKAKLDLQYTRVFAPTSGYIANFNLRHGDVVSAYQPLFALIEDQTWWAQANF
KETQLARIHTGEQATIKLDMYPHQIFIGKVVDVNKDSGSSFSLLPPENASGNWVKVTQRF
PVKVIITQRKSGYPLRLGASSTVTIDTTSPK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaatttgttaaagtcattctgcctcttttcataatcgcgattctttccatc
ggcggttatttttactggcaacatcaaaaccgctaccccagcacagatgacgcctacatc
caagctgacgttattaacgtagcttctcgggttagcgggaccgtaagcgagatcgatgtt
cgcaatgaagaacatgtccaaaaaggacaactcctattcaccattgacccagcgccgttt
accatcgagcttaataaggcgcaagcgcaacgagatgctacccgccaaaaaattcaagcg
gctgatatggcagtaaaatccgctagggccaccgtggtagaaagaaaagcagaacttacc
catacccgtctggaaacaaaacgtatactcaccttaatgaaaaagcaatttgtttctcgc
tcggacggtgacctcgctattaaaaatttacatgttgctgaagctgccctgaatgcagca
caaaaccaattggaagaaatgattgaaaaacgcggtgaattaggcgacaaaaacgcccaa
ttgcgtctagcgcaagctgccgttgaaaaagccaaattagatttgcaatacactcgcgtt
tttgcgcccacttcaggctacatcgctaattttaatttacggcacggcgatgtagtgagc
gcttatcaacctttattcgctttaatcgaagaccaaacctggtgggctcaagccaatttt
aaagagacccaactggctcgtattcacactggcgaacaagccaccatcaagttagacatg
taccctcatcaaatatttatcggcaaagtcgtcgatgttaacaaagacagcggcagtagt
ttttccttgctgccccctgaaaacgctagcggcaattgggttaaagtcactcagcgtttt
ccagtcaaggtcattattacccaacgcaaatcgggctatcctcttcgtttgggcgccagt
agcacggttaccatagacacgacctctccaaaataa

DBGET integrated database retrieval system