KEGG   Clostridium botulinum E3: CLH_0625Help
Entry
CLH_0625          CDS       T00767                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cbt  Clostridium botulinum E3
Pathway
cbt00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CLH_0625
Enzymes [BR:cbt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CLH_0625
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CLH_0625
    1.1.1.-  
     CLH_0625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ApbA Oxidored_nitro PALP ADH_zinc_N_2 2-Hacid_dh_C Pyr_redox NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ACD54103
LinkDB All DBs
Position
631160..632233
Genome map
AA seq 357 aa AA seqDB search
MKAALWYAKKDVRVEEIEEPKVTSNGVKIKVKWCGICGSDLHEYLGGPIFIPVGQPHPLS
GTTAPVVLGHEFSGDIVEVGENVTKFKVGDRVIVEPIVACGKCPACLEGKYNLCSSLGFH
GLCGSGGGLAEYTVFPEEFIHKIPDEMSYEQAALVEPMAVALHSIRVGNFKIGDTALVLG
SGPIGLATIECLKAAGAKLVVVLQRKSIRQEYAKRAGADVVLDPNEVDIAEEVKKLTNGL
GVDVAFETTGAQIGFDTGINSLKFEGTMVITSIWENGVTFNPNALVFTEKNIVGTLAYRH
EFPATMAQMNDGRIKAEGYVTKRIHLDDIVEEGFGALTGPEKKKHVKILVTPDKGLL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcattatggtatgcaaagaaagacgttagagtagaagaaattgaagaacca
aaggttacaagcaatggtgtgaaaataaaagtaaaatggtgtgggatatgtggatcagac
ttacatgaatatttaggaggacctatatttattccagtaggacagcctcatccattaagt
ggaacaactgcaccagtagttttaggtcatgaattttcaggtgatattgtagaagttggt
gaaaatgtaacaaagtttaaggttggagatagagtaattgttgaacctatagttgcatgt
ggaaaatgtccagcatgtttagaaggaaaatataatttatgttcatctttaggattccat
ggtctttgtggcagtggtggaggacttgcagaatatacagttttcccagaagagtttata
cataaaataccagatgaaatgtcttatgaacaagcagctttagttgaaccaatggcagta
gcattacattcaattagagtaggaaactttaaaattggagatacagcattagtattaggt
tctggtcctataggattagcaactatagaatgcttaaaagcagcaggtgcaaagttagta
gtagtattacaaagaaaatccataagacaagaatatgctaaaagagcaggcgctgatgtt
gtattagatcctaatgaagttgatatagcagaagaagttaaaaagcttacaaatggatta
ggcgtagatgtagcatttgaaactacaggagctcaaataggtttcgacacaggtattaat
agtttaaaattcgaaggaactatggttataacaagcatatgggaaaatggagttacattt
aatcctaatgctttagtatttacagaaaagaatatagttggaacattagcatatagacat
gaatttccagcaaccatggctcaaatgaatgatggaagaataaaagcagaaggatatgta
actaagagaatacacttagatgacatagtagaagaaggatttggagcattaacaggtcca
gaaaagaagaaacacgttaagatattagtaacaccagataaaggtcttttataa

DBGET integrated database retrieval system