KEGG   Clostridium botulinum E3: CLH_0645Help
Entry
CLH_0645          CDS       T00767                                 

Definition
(GenBank) putative methyl-accepting chemotaxis sensory transducer
Organism
cbt  Clostridium botulinum E3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal DUF948 EzrA RsbRD_N
Motif
Other DBs
NCBI-ProteinID: ACD51898
LinkDB All DBs
Position
649405..650865
Genome map
AA seq 486 aa AA seqDB search
MKKGTYELERANILNIKLLLFLCLTLIVQSYVLHGLVRGTTTLAFCAFVTVCALCIKKFV
NTPVICGIGIPLIIMISELAFVILAGGTGFAIILFLSTLVMSSLYFDHKIIIIYSIILNA
IILFIQFIIGFNLLGKGQGIDIFITQFTAVIISEVTLYFMVKWAKEALESSIHSQNEIKS
AILKISNTNSNIVSQIDTLNESTKSTKNQSQSVTRAMEEIIQGIEVQVTSMSDITNSVEY
IKEEINSTLELSNEIEESSKNLSIKTDENFSSINIASDHINSIRTIMSEANLTVIEFSDN
MKQVINVLRGIKEISEQTNLLALNASIEAARAGESGKGFAVVADEVRSLSEKTKETTNEI
EESILGIQSKIEMVVKSVKKGDEEAEKGRDIIESTLISFKDMQKMFENIKDDIYKEYELV
EKINSLVDNVQSNVESTTAITEQYVANTEEVTTLQEEQEEQINSIQESVENIYNEATELT
NLFAND
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggggacatacgaattagaaagagcaaatattttaaacattaaattattatta
tttttatgcttaacattaatagtgcaatcatatgttttacatggattagttaggggtaca
actacattggcgttttgtgcatttgtaactgtatgtgcattgtgcattaaaaaatttgta
aatacacctgtgatatgtgggatagggattccacttattataatgatatcagaattggct
tttgtaattttagctgggggaacaggttttgcaataatattgtttttatctacattagta
atgagttcattatactttgatcataaaataataataatctattcaataatattaaacgca
attatactatttattcaatttataataggctttaatttattaggaaaaggacaaggtata
gatatatttataacacaatttaccgcagtaataatatctgaagtaacattatattttatg
gtcaaatgggctaaggaggcactagaaagttcaattcattctcaaaatgaaataaaatct
gctattttaaaaattagtaatactaatagcaatatagttagtcaaatagatacattaaat
gaaagtactaaaagcacaaaaaatcaatcacaaagtgtaacacgggcaatggaagaaata
attcaaggaatagaagttcaagtgactagtatgtctgatattacaaattctgttgaatat
atcaaggaggaaataaattcaacattagaattatctaatgaaattgaggagagttctaag
aatcttagtataaaaacagatgagaacttttcaagtattaatatagcaagtgatcatatt
aatagcattagaactataatgagtgaagctaatttaacagtaatagaattcagtgataat
atgaaacaagttataaatgtacttagaggaataaaagaaatttcggaacaaactaatctt
ttagcacttaatgcatctatagaagcagcaagagcaggagagtctggtaagggatttgct
gttgttgcagatgaagtaagaagcttatctgaaaaaactaaagaaacaactaatgaaata
gaggaatctatattaggtatacaaagtaagatagaaatggtagttaagtctgttaaaaaa
ggtgatgaagaagctgaaaaaggtcgagacatcatagaatctactttgattagttttaaa
gatatgcaaaaaatgtttgaaaatattaaagatgacatatataaagaatatgaattagtg
gaaaaaataaattcattagtagataatgtacaatcaaatgttgagagtacaacagctatt
actgaacaatatgtagctaatacagaagaagtaacaacactacaagaagaacaggaagaa
caaattaatagtatacaagaaagtgttgaaaacatatataatgaagcaacagaactgacg
aatttatttgcaaatgattaa

DBGET integrated database retrieval system