KEGG   Clostridium botulinum E3: CLH_1486Help
Entry
CLH_1486          CDS       T00767                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cbt  Clostridium botulinum E3
Pathway
cbt00473  D-Alanine metabolism
cbt01100  Metabolic pathways
cbt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cbt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CLH_1486 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CLH_1486 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbt01011]
    CLH_1486 (alr)
Enzymes [BR:cbt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CLH_1486 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cbt01011]
 Precursor biosynthesis
  Racemase
   CLH_1486 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C FCH
Motif
Other DBs
NCBI-ProteinID: ACD53922
LinkDB All DBs
Position
complement(1586031..1587191)
Genome map
AA seq 386 aa AA seqDB search
MEKIMRPVWAEIDLDAIAYNMKNIKKLAQNKDVIAVVKADCYGHGALDVVPTLLENGASR
LAVAVLTEAIELRNNNVNAPIMILGYTPEYLFEEVVNYDIEQTVYDLEYAKKLSHLAIKF
NKKAKIHIAIDTGMGRIGFIPNEKAIKDIKEIYDLKGIDVIGIFTHFSTSDETDKEYTNE
QFNKFTSFIDMLSKVGVKIPIKHISNSGAIIDLPKTYLDSVRAGIILYGYYPSDEINKDN
IKLKPALTLKASLTRVQELDINSYISYGKTFKTERKSIIATLPIGYADGYSRLLAPGAKV
IINGQFAPIVGRICMDQCMIDVTDIDNVNVGDEVIILGEDDNLKLTANDLANSMGTINYE
ILCMLKYRIPRVYIKNGEIFNVRNYL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaataatgagaccagtatgggcagaaatagatttagatgcaatagcgtataat
atgaaaaacataaaaaaattagcacagaataaagatgtaattgcagttgtaaaagctgat
tgttatggtcatggagctttagatgtagttcctacactacttgaaaatggtgcatctaga
cttgcagttgctgttttaactgaagcaattgagcttagaaacaacaatgtaaatgctcca
attatgattttaggatacactcctgaatatttatttgaagaagtagttaattatgatata
gaacaaactgtttatgatttagaatatgcgaaaaaattatcacatttggctataaaattt
aataaaaaagctaaaattcatattgctattgatacaggtatggggagaattggatttatt
ccaaatgaaaaagcaattaaagatattaaggaaatatatgatttaaaaggtatagatgta
attggtatatttactcatttttcaacttctgatgaaactgacaaagaatatactaatgaa
caatttaataagtttacatcttttatagatatgctttcaaaggttggcgttaaaattcca
ataaagcatatatctaatagtggtgctattatagatctgccgaaaacttatttagacagc
gtcagagctggtataatactttatggatactatccatctgatgaaataaataaagataat
attaagttaaaaccagctcttactctaaaagctagtttaacacgtgtacaagaattagat
ataaacagctatataagctacggtaaaacatttaaaactgaaagaaaaagcattatagca
actttgcctattggatatgctgatggatattctagattgcttgctcctggtgctaaagtt
ataataaatggacaatttgctccaattgttggtcgaatatgcatggatcaatgtatgatt
gatgttaccgatatagataatgtcaatgttggagatgaagtaataattcttggtgaggat
gataatttaaaattaacagctaatgatcttgctaattctatgggaacaataaattatgag
attctttgtatgcttaaatatagaatacctagagtttatataaaaaatggcgaaatattt
aatgttagaaattatctttaa

DBGET integrated database retrieval system