KEGG   Clostridium botulinum E3: CLH_1802Help
Entry
CLH_1802          CDS       T00767                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase (Mn)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cbt  Clostridium botulinum E3
Brite
Enzymes [BR:cbt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CLH_1802 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACD51346
LinkDB All DBs
Position
complement(1931369..1931983)
Genome map
AA seq 204 aa AA seqDB search
MFNKIELPYNYDALEPYIDKETVDIHYNKHLQTYVNNLNNILKGHEEFVNEKSLGKILSD
VNSIPEEIRQGVINQGGGVFNHNLYFSILSPTPKKAPEGKLLDEINNSFGNLEDLKDKIS
NAAIGQFGSGYGFLVKDENGKLSVTSVLNQNNPLSNNLIPILCIDVWEHAYYLKYKNLRA
DYVKNIWNIIDWAKVEDLYMNYSI
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtttaataaaattgaattaccatataattatgatgctttggaaccatatatagataag
gaaacagtagatatacattataataaacaccttcaaacttatgtaaataatttaaacaat
attttaaaaggtcatgaagaatttgtgaatgaaaaatcactaggaaaaatattatctgat
gtaaattctatacctgaagaaattagacaaggagttataaatcaaggtggtggagtattt
aatcataatttatatttttctattctttcaccaacacctaaaaaggctccagaaggaaaa
ttattagatgaaataaataatagttttggaaatttagaagatttgaaagataaaataagt
aatgctgcaataggacaatttggatctggatatggatttttagttaaagatgaaaatggt
aaattatctgtaacaagtgtattaaatcaaaataatcctcttagcaacaatcttattcct
atattatgtatagatgtttgggaacacgcatattatttaaaatataaaaatctaagagct
gattatgttaaaaatatttggaatataattgattgggcaaaagtagaagatttatatatg
aattattcaatttag

DBGET integrated database retrieval system