KEGG   Clostridium botulinum E3: CLH_1935Help
Entry
CLH_1935          CDS       T00767                                 

Gene name
dhaT
Definition
(GenBank) 1,3-propanediol dehydrogenase
  KO
K00086  1,3-propanediol dehydrogenase [EC:1.1.1.202]
Organism
cbt  Clostridium botulinum E3
Pathway
cbt00561  Glycerolipid metabolism
cbt00640  Propanoate metabolism
cbt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CLH_1935 (dhaT)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CLH_1935 (dhaT)
Enzymes [BR:cbt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.202  1,3-propanediol dehydrogenase
     CLH_1935 (dhaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: ACD52883
LinkDB All DBs
Position
complement(2089091..2090248)
Genome map
AA seq 385 aa AA seqDB search
MRMYDYLVPSVNFMGAGCVKLVGERCQILGGKKALIVTDKFLRNMEGGAVELTVKSLQEA
GIEVAYYDSVEPNPKDTNVADGLKIFQDEKCDMIVTVGGGSAHDCGKGIGIVATHEGDLY
EYAGIETLTKALPPIVAVNTTAGTASEVTRHCVITNTKTKVKYVIVSWRNLPLASFNDPE
LMVKKPAGLTAATGMDALTHAIEAYVSKDANPVTDAAAIQAIKLISNNLRQAVALGENLV
ARENMAYGSLLAGMAFNNANLGYVHAMAHQLGGLYDMPHGVANAMLLPHVEKYNLISNPQ
KFADIAEFMGENIQGLSVMEAAEKAIDAMFRLSTDIGIPTSLKEMGIKEEDFEYMAEMAL
KDGNAFSNPRKGNEKDIVAIFKAAF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgtacgattatttagtaccaagtgttaactttatgggcgctggatgtgtaaaa
ttagtaggagaaagatgtcaaatattaggcggaaaaaaagctctaatagtaacagataaa
ttcttaagaaacatggaaggtggagcagtagaattaactgttaaatcattacaagaagct
ggaatagaagttgcatactatgattcagttgaaccaaatccaaaagatacaaacgttgct
gatggattaaaaatattccaagatgaaaaatgcgatatgatagttacagttggaggcgga
agtgctcatgactgtggtaaaggtattggtatagttgctactcatgaaggagatctttat
gaatatgctggaatagaaactttaactaaagctcttccaccaatagttgcagttaatact
acagctggaacagcaagtgaagttacaagacattgtgttataactaacactaaaactaaa
gttaaatatgttatagttagctggagaaacttaccattagcttcattcaatgatccagaa
ttaatggttaaaaaacctgcaggtttaacagctgctacaggaatggatgcattaactcat
gctatcgaagcttatgtatcaaaagatgcaaaccctgtaactgatgctgctgctatacaa
gcaataaaattaatatcaaacaacttaagacaagcagttgctttaggtgaaaacttagta
gcaagagaaaacatggcatacggttcattattagctggtatggcattcaacaatgctaac
ttaggatacgttcatgctatggctcaccaattaggtggattatacgacatgccacatgga
gtagctaatgctatgcttcttccacatgttgaaaaatacaacttaatctcaaacccacaa
aaatttgctgatatagcagaattcatgggagaaaacatacaaggattatcagttatggaa
gcagcagaaaaagctatagatgctatgttcagactttcaactgatatcggaattcctaca
agcttaaaagaaatgggaataaaagaagaagatttcgaatacatggctgaaatggcatta
aaagatggtaatgcattcagtaacccaagaaaaggaaacgaaaaagatatagttgcaata
tttaaagctgcattttaa

DBGET integrated database retrieval system