KEGG   Coxiella burnetii RSA 493: CBU_0009Help
Entry
CBU_0009          CDS       T00124                                 

Gene name
dacB
Definition
(RefSeq) D-alanyl-meso-diaminopimelate endopeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
cbu00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cbu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CBU_0009 (dacB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cbu01002]
    CBU_0009 (dacB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbu01011]
    CBU_0009 (dacB)
Enzymes [BR:cbu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CBU_0009 (dacB)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     CBU_0009 (dacB)
Peptidases [BR:cbu01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   CBU_0009 (dacB)
Peptidoglycan biosynthesis and degradation proteins [BR:cbu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CBU_0009 (dacB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 ZnuA Peptidase_S11
Motif
Other DBs
NCBI-GeneID: 1207871
NCBI-ProteinID: NP_819065
UniProt: Q83FD1
LinkDB All DBs
Position
9560..10993
Genome map
AA seq 477 aa AA seqDB search
MKKPFYLAILLSLFCSPLFAVEKQNPQTNINTILRSIKSKANLGFIVSDVKTGRVIFSER
SQFLFSPASTQKLFTAVAALYYLGSDYQFTTALLTNGAIKGQTLQGNLTLKFSGDPELTT
EDLNRLIEKLKELGIHRISGHVYIDNTAYNDVPYPPGWMLDDLSYGYAAPVSAIIINRNK
FLLHILPAKKGNAQPTLSPILPAGVAHFSNRVRTTAHQIKQCPLTVYSDNRNNYQLAGCI
NRAWGQQRRTLAIRNPVIYANVLLKQALADNVIQYQGPILLAGSSANDVVLAEQKSPPLR
HMLKEMLKNSDNLTTDSLLKKMGERFYKKPGTWQNGLHALKKILEPTGIDFKNNLINDGA
GLSRYNLVSPDQMAKLLRFAYNQKTIRDPLLKALPIGGKDGTLAGRMRSIANSERVHAKT
GSMAGVSALAGYLRTRQNKVLSFAIMINGFVGETHAYSHLEDRLCEFLVKFSERKHG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcctttctaccttgcaattctcttaagtttattttgctcaccgctttttgct
gtagaaaaacaaaacccgcaaacgaatattaatactattctgcggtccattaaatccaaa
gctaatttgggttttattgttagcgatgtcaaaacaggtcgtgttatttttagcgaacgc
tcacaatttttgttttcgccggcaagcacacaaaaattatttacggccgtagcggcactg
tattatctcggctcggattatcaattcaccacggcacttctcactaacggcgccatcaaa
ggccaaactttgcaaggaaatttaaccctcaaattctctggcgatcctgaactgacgaca
gaagatttaaatcgactgatcgaaaaactaaaagaactgggcatccatcgcattagtggc
catgtctacatcgataataccgcttataacgacgttccttatccgccgggttggatgttg
gatgatttaagttatggttatgccgctccggtgagcgccattattatcaaccgcaataaa
tttttattgcatattttgccggccaaaaaaggcaatgcccagccaacgctatcgcctatt
ctccccgcgggcgtggctcatttttctaatcgcgtaagaacaactgcccatcaaattaaa
cagtgcccgttgactgtttacagtgataatcgcaataactatcaattggcaggctgcatt
aatcgcgcgtggggacagcagcgacgcacactagccattcgaaatccggttatttacgcc
aacgtgttactcaaacaggcgctcgctgataatgttattcagtaccaaggtccaattctc
ttagcaggttctagtgctaatgatgtcgtactagcggagcaaaaatcgccaccgcttcgc
catatgttaaaagaaatgttgaagaattctgacaatttaacgacggattcattgctaaaa
aaaatgggggaacgattttataaaaaaccaggtacttggcaaaacggactgcacgcatta
aaaaaaatattagaaccgaccggtattgatttcaaaaataatttaattaatgacggtgca
ggcctttcgcgttataacctcgttagtccggatcaaatggcaaaattactgcgttttgct
tacaatcaaaaaaccattcgcgatcctttgttaaaagcacttcctattggcggcaaagat
ggaacgcttgccggacgcatgcgctccattgctaattccgaacgagtccacgctaaaacc
ggctcaatggcaggggtttcagccttagcgggctatttgcgaactcgccagaataaggta
ttatcctttgcgatcatgattaatggtttcgttggcgaaacccatgcctatagtcattta
gaagatcgtctgtgcgaatttctggtaaaattttctgagcgaaaacatggataa

DBGET integrated database retrieval system