KEGG   Coxiella burnetii RSA 493: CBU_0036Help
Entry
CBU_0036          CDS       T00124                                 

Definition
(RefSeq) (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
cbu00061  Fatty acid biosynthesis
cbu00780  Biotin metabolism
cbu01100  Metabolic pathways
cbu01212  Fatty acid metabolism
Module
cbu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cbu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CBU_0036
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CBU_0036
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cbu01004]
    CBU_0036
Enzymes [BR:cbu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CBU_0036
Lipid biosynthesis proteins [BR:cbu01004]
 Fatty acid synthase
  Component type
   CBU_0036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-GeneID: 1207898
NCBI-ProteinID: NP_819091
UniProt: Q820X6
LinkDB All DBs
Position
complement(32176..32655)
Genome map
AA seq 159 aa AA seqDB search
MNTFIENLQPYSATELVEAIPQKPPFRFIDKILSVDENCIEGIYTFKPTEFFYQGHFPSN
PLTPGVILLESMAQVGLVAFGLYLLSKEMARNEVMNLVTLFTEANVEFLSPIKPTDTITI
HAEKTLWRRKKLKSHAKAHKADGTLVGIAELGGIGVRNL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaatacctttatcgaaaatttacagccctatagcgcgactgaactcgttgaggctata
ccacaaaaacctccttttcggtttatcgataaaatcctttccgtcgatgaaaactgtatc
gaaggtatttatacttttaaaccaacagaatttttttaccaaggccattttcctagcaac
ccattaacgcctggagtaattttgttagaatcaatggcgcaagtgggtttagtggcattc
ggcttgtatctcttgtccaaagaaatggcgagaaacgaagtgatgaatttagtgacttta
tttacagaggcaaatgttgaatttttatcgccaatcaaaccgactgatacgataactatc
cacgcagaaaaaaccttatggcgacgaaaaaaattaaaaagccatgccaaagcccataag
gcagatgggacgctagttggtattgctgagcttggcggcatcggagtgaggaacttatga

DBGET integrated database retrieval system