KEGG   Coxiella burnetii RSA 493: CBU_0037Help
Entry
CBU_0037          CDS       T00124                                 

Gene name
fabA
Definition
(RefSeq) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
cbu00061  Fatty acid biosynthesis
cbu01100  Metabolic pathways
cbu01212  Fatty acid metabolism
Module
cbu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cbu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CBU_0037 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cbu01004]
    CBU_0037 (fabA)
Enzymes [BR:cbu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CBU_0037 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     CBU_0037 (fabA)
Lipid biosynthesis proteins [BR:cbu01004]
 Fatty acid synthase
  Component type
   CBU_0037 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-GeneID: 1207899
NCBI-ProteinID: NP_819092
UniProt: Q820X5
LinkDB All DBs
Position
complement(32659..33276)
Genome map
AA seq 205 aa AA seqDB search
MKIKYEDFKKKTTFSKEEMVALTWGHLIKDPPPEGIPALPAPPLLMVDRVLSVEHTGSRG
KIIAETDIHLDDWFFQCHFRHDPVKPGCLGVDAIWQLLGLYISLRGGVGSGRALGAKEVD
FFGQIRPHNKVVRYEVSIRRYSHLEQQGVSMVLGDGSVFVDGEQVYQINQAKVGSFLNIR
YDDYPLKSQHAIGGVMAVNRMEETI
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaaatacgaagatttcaaaaagaaaaccaccttttccaaagaagaaatggtt
gcattaacgtgggggcatctgattaaagacccgccccccgaaggcattccggcgctgcct
gcaccgccactgctgatggtcgatcgcgttctttccgtggagcacacgggcagtcgtggc
aaaattatcgccgaaacggatatccacttagatgattggtttttccaatgtcattttcgt
catgaccccgtaaaacctggttgcttaggcgttgatgcgatttggcaattattggggtta
tatatctccttacgcggtggcgtggggtcggggcgtgctttgggtgcaaaagaagtcgat
ttttttggacaaattagaccgcacaacaaagtggtccgttacgaagtttctatccgacgt
tattctcatctggaacaacaaggagtttccatggtgttgggcgatggcagcgtattcgtc
gatggcgagcaggtatatcaaattaatcaagctaaagtgggttcgtttttaaatattcgt
tatgacgactatccattgaaatcccaacacgctattggcggtgtgatggcggttaaccgc
atggaggaaacgatttaa

DBGET integrated database retrieval system