KEGG   Coxiella burnetii RSA 493: CBU_0118Help
Entry
CBU_0118          CDS       T00124                                 

Gene name
ftsI
Definition
(RefSeq) cell division protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
cbu00550  Peptidoglycan biosynthesis
cbu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cbu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CBU_0118 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CBU_0118 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbu01011]
    CBU_0118 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cbu03036]
    CBU_0118 (ftsI)
Enzymes [BR:cbu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CBU_0118 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:cbu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   CBU_0118 (ftsI)
Chromosome and associated proteins [BR:cbu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    CBU_0118 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-GeneID: 1207989
NCBI-ProteinID: NP_819168
UniProt: Q83F33
LinkDB All DBs
Position
108474..110132
Genome map
AA seq 552 aa AA seqDB search
MSNPVQRAWRFYALWFLLSVAVAGLLWRLIDLNVLDRSFLLRQSKARVLRVVNIPAYRGM
ITDRLGVPLAISTPVDSVWINPQLFQATPIQLKQLAHLLHLPLSFIKKRAKKMGDRQFVY
LKRGNPPFVAKQIRGLNISGVFFQREYRRYYPEGEVAAHVVGLTNIDDQGQEGLELAYNR
WLGGTPGKMEVLKDRLGHVIADVAVLQKPAQGHDLNLSIDHRIQYLAYKALEETVSTYHA
QSGSVVVLDVKTGEILAMVNQPSYNPNNRPTDHDGRYRNRAVTDMFEPGSVNKPFTIALA
LESGRYKPDTQINTNPGWMKIGGYRIHDDLNYGVVTLTQLLQKSSNIAAAKILLSLTPQH
YYTLLHAFGFGERTTSGFPGESNGALIPYETWVPSVVATLAYGYGLAVTTLQLAQGYAVL
AAGGIRKPVTFVKVNESPQGVRVLPENVAKTVIKMLETVVQKGGTGTRAQVYGYSVAGKT
GTAYIAGPNGYFKHRYVASFVGIAPANNPRLVVAVVIRDPQGQHFGGIVAAPLFSKIMSG
ALRILDVPPDNS
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaacccagtgcaacgcgcttggcggttttacgcgttatggtttttactgagtgtc
gcggtggccggattattatggcgattgatcgatttaaacgtcctggatcgatcttttcta
ctgaggcaaagtaaggcgagggtcctccgtgtcgtcaatattccggcctatcgcggtatg
attaccgaccgattgggcgtaccgttagccattagtacgccagtggattccgtatggata
aatccgcaattatttcaagcgacgccgattcaattaaaacagcttgctcaccttttacat
ctccccctttcgtttattaaaaagcgagccaaaaaaatgggggatcgtcagttcgtttat
ttaaagcgcggtaatcctcctttcgtagcaaaacaaattcgtgggctaaatatttcgggc
gttttttttcagcgtgaatatcggcggtattatccggaaggtgaagtggctgctcatgtg
gttgggttgacgaatatcgacgatcaaggacaggaagggctagagctcgcttataatcga
tggcttgggggaacgccgggtaaaatggaagtgttaaaggatcgtctcggccacgtgatt
gctgatgtggccgtgttgcaaaaacccgcccaaggacatgatttaaatttaagtatcgat
catcgaattcaatacttggcgtataaagcgttggaggaaacggtttccacttatcacgca
caatcgggttctgtagtcgtgctcgatgtaaaaacgggtgaaattttagcgatggtaaac
cagccgagttacaacccgaataaccgcccgaccgatcacgacggacggtatcgtaaccga
gcggtgacggatatgtttgaaccaggctctgtcaataaacccttcacgatcgcgcttgct
ttggaaagcggtcgatataaacccgatacccaaattaataccaaccccggatggatgaaa
atcggcggttaccgcattcacgatgatttaaattacggcgttgtcacgctgacgcaatta
ttgcaaaaatcaagcaatatcgccgccgctaagattttgttatcattgacgcctcagcat
tattacactttattacacgcatttggttttggtgaaagaaccacgagcggattccctggc
gaatctaatggtgctttgatcccttatgaaacatgggttccgagcgtcgttgccactttg
gcttatggatacggacttgcggtaaccacgttgcaactcgctcaaggctacgcagtttta
gccgccgggggtataagaaaaccggttacgtttgttaaagtgaacgagtccccgcaaggc
gttcgggttttgcccgaaaacgtcgcaaaaaccgtaataaaaatgcttgaaaccgttgtt
caaaagggaggaacgggtacgcgtgcacaagtctatggttatagcgtggcaggaaaaaca
gggaccgcttatattgccggaccgaatggttatttcaaacaccgctacgtagcttcattc
gtcggtatcgcgccagcgaataatccacgcttagttgtcgccgtcgtaattcgcgatccc
caaggccagcatttcggcggaattgtagccgctcctttattttcaaaaatcatgagcggc
gctttgcgcatattagatgtgccaccggataattcgtag

DBGET integrated database retrieval system