KEGG   Coxiella burnetii RSA 493: CBU_1400Help
Entry
CBU_1400          CDS       T00124                                 

Gene name
sdhB
Definition
(RefSeq) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
cbu00020  Citrate cycle (TCA cycle)
cbu00190  Oxidative phosphorylation
cbu00650  Butanoate metabolism
cbu01100  Metabolic pathways
cbu01110  Biosynthesis of secondary metabolites
cbu01120  Microbial metabolism in diverse environments
cbu01130  Biosynthesis of antibiotics
cbu01200  Carbon metabolism
Module
cbu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cbu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cbu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cbu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CBU_1400 (sdhB)
   00650 Butanoate metabolism
    CBU_1400 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CBU_1400 (sdhB)
Enzymes [BR:cbu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CBU_1400 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     CBU_1400 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_18 Acetone_carb_G Fer4_9
Motif
Other DBs
NCBI-GeneID: 1209306
NCBI-ProteinID: NP_820385
UniProt: P51053
LinkDB All DBs
Position
complement(1354381..1355112)
Genome map
AA seq 243 aa AA seqDB search
MNSKKSRIMTFSIMRFNPETDKKPYMQDFELDVSAIQGKMLLNALEALREKHPDIGLRRS
CAEGVCGSDGMNINGKNALACVTQLKDLPDRVVVRPLPGFPIIRDLIVDMEQFYAQYKKV
KPYLLNDQEAPQKERLQSPEERAKLDGLYECILCACCSSSCPSYWWNPDKFIGPAGLLWS
YRFIADSRDSKEKERLDAMKDPYSVFRCRTIMDCATVCPKNLNPAKAIRKIRTEMLQETE
SGE
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaattctaaaaaatcacgaatcatgactttctcaattatgcgctttaatccagaaacg
gataaaaaaccttacatgcaagattttgaattggatgtttctgccattcagggaaaaatg
ctactcaatgctttagaagcccttcgagaaaaacaccccgatatcggtttgcgacgttcg
tgtgcggaaggcgtttgtggctcggatggaatgaatatcaatggcaaaaatgccttagct
tgcgtgacccaattaaaagatttgcccgaccgtgtcgtcgttcgaccattaccgggcttt
cctattattcgtgatttaattgtggatatggagcagttttatgctcaatataaaaaagtg
aaaccttatcttttaaatgatcaggaggctcctcaaaaagagcggctgcaaagtccagaa
gaacgggctaaattagatggattatacgaatgtattttatgcgcctgttgttcttcttct
tgtccttcctattggtggaatccagacaaatttattggaccggcgggtttattatggtcg
tatcggtttattgcggatagtcgcgactccaaggaaaaagaacgcctcgatgcaatgaag
gacccctacagtgtttttcgttgtcgtaccattatggattgcgcgacggtatgccctaaa
aatcttaaccctgctaaagcaatccggaaaatccgcaccgaaatgcttcaggaaacagaa
agcggggaataa

DBGET integrated database retrieval system