KEGG   Coxiella burnetii RSA 493: CBU_1401Help
Entry
CBU_1401          CDS       T00124                                 

Gene name
sdhA
Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
cbu00020  Citrate cycle (TCA cycle)
cbu00190  Oxidative phosphorylation
cbu00650  Butanoate metabolism
cbu01100  Metabolic pathways
cbu01110  Biosynthesis of secondary metabolites
cbu01120  Microbial metabolism in diverse environments
cbu01130  Biosynthesis of antibiotics
cbu01200  Carbon metabolism
Module
cbu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cbu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cbu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cbu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CBU_1401 (sdhA)
   00650 Butanoate metabolism
    CBU_1401 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CBU_1401 (sdhA)
Enzymes [BR:cbu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CBU_1401 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     CBU_1401 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO HI0933_like FapA Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 1209307
NCBI-ProteinID: NP_820386
UniProt: P51054
LinkDB All DBs
Position
complement(1355119..1356882)
Genome map
AA seq 587 aa AA seqDB search
MSSIRVKQYDALIVGAGGAGLRAALEMAQSRQYKVAVVSKVFPTRSHTVSAQGGIAAALG
NVVPDKPIWHMFDTVKGSDYLGDQDAIQYMCEQAPPSVYELEHYGLPFSRLDDGRIYQRA
FGGHTRDFGKEMARRTCACADRTGHAMLHTLYQKNVEAGTHFYYEWYGIDLVRGAQGGIA
GMIAMNMETSELVFFKSRATIFATGGAGRIYETTSNAYTNTGDGIGMVLRAGLPVQDMEF
WQFHPTGIYGVGCLITEGARGEGGYLINKDGERFMERYSPHLKDLDCRDVVARSILQEVM
AGGGVGPKKDHVLLKLDHLGEKVLRERLPGIIELSEKFANVDITKEPIPILPTCHYMMGG
IPTNIHGQALTVDENGKDQIIEGLFAAGECACVSVHGANRLGTNSLLDLVVFGRAIGLHL
EEALKTELKHRSENPDDIDAAIARLKRWEKPNNVENPALLRQEMRKAMSEDFGVFREEQK
MKQGLERLQKLNERLQRAKLTDTSRTFNNARIEALELDNLMEVSYATAVSAQQRTESRGA
HSRYDYKERDDANWLKHTVYFRDGHIAYRPVNMKPKGMDPFPPKSRD
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgagctctattagagtcaaacaatacgatgctctcatcgtaggagcgggcggggcgggc
ctacgcgccgcattggaaatggcgcaatctcgtcagtataaagtcgccgttgtatcaaaa
gttttccccacgcgatcgcacaccgtttccgcgcaaggtggcatagcggccgctttgggc
aatgtggtgccggataaaccgatttggcatatgttcgatacggttaaaggatcggactac
ttaggcgatcaagacgccattcaatacatgtgtgaacaggccccgccttccgtgtacgaa
ttggaacattacggacttcccttttcgcgattggatgacggtcgcatctatcaacgcgct
tttggcggccacacgcgcgatttcggtaaagaaatggctcggcgcacatgcgcctgtgca
gaccgaaccggtcatgccatgctccatacgttgtaccaaaaaaatgtagaagcaggtacc
catttttattatgaatggtatggaatcgatttagttcgcggtgcacaaggcgggattgcc
ggcatgatcgcaatgaatatggaaaccagtgagttggtttttttcaaatcacgagcgacg
attttcgccaccgggggagcgggccgtatttatgaaacaaccagtaacgcttataccaac
acaggtgatgggattggtatggtgttgcgagctgggttacccgtgcaagacatggagttt
tggcaattccatccgacgggtatttacggtgtgggttgtttgattacagaaggcgcgcgt
ggtgagggcggttatcttattaataaagacggtgaacgttttatggaacgttattctccg
catttaaaagacctcgattgccgcgacgtcgttgcccgttctatcttacaagaagtcatg
gccggcggtggcgttggcccgaaaaaagatcacgtcttacttaaattggatcatttggga
gaaaaagtattacgagagcggctccctggtatcatcgaattatccgaaaaatttgcaaac
gtcgatatcacaaaagaacccatccctattttaccgacctgccattacatgatgggtggc
attcccaccaatattcatggtcaggcgctcacggtggatgaaaatggtaaggatcaaatt
atcgaaggcctgtttgccgcgggagaatgcgcgtgtgtttctgttcatggggcaaatcgg
ttagggactaattcattattagacttagtcgtctttggtcgtgccattgggttgcatttg
gaagaggccttaaaaaccgaattgaaacatcgttctgaaaatcccgatgatattgatgct
gccatcgctcgcctaaaacgctgggaaaaacccaataacgttgaaaatcccgcattactt
cgacaggaaatgcgaaaagctatgtcggaagacttcggcgtgttccgcgaagagcagaaa
atgaagcaggggctggaacgtctgcaaaaattgaatgaacggttacagcgcgcgaaatta
accgataccagtcgcactttcaacaatgcccgaattgaggccttagaactcgataattta
atggaagtctcttacgctaccgccgtttcagcgcagcagcgtacggaaagccgaggcgct
cattcccgttatgattataaagaacgcgacgatgcaaattggctgaaacacaccgtttat
tttcgcgacgggcacatcgcttaccgccctgtcaatatgaaacccaaagggatggacccg
tttccccctaaatcgagagattga

DBGET integrated database retrieval system