KEGG   Clostridium butyricum: ATN24_05795Help
Entry
ATN24_05795       CDS       T04197                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cbut  Clostridium butyricum
Pathway
cbut00473  D-Alanine metabolism
cbut01100  Metabolic pathways
cbut01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cbut00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ATN24_05795
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    ATN24_05795
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbut01011]
    ATN24_05795
Enzymes [BR:cbut01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ATN24_05795
Peptidoglycan biosynthesis and degradation proteins [BR:cbut01011]
 Precursor biosynthesis
  Racemase
   ATN24_05795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ALP89662
UniProt: A0A0Q0TYM1
LinkDB All DBs
Position
1:complement(1248916..1250082)
Genome map
AA seq 388 aa AA seqDB search
MEKILRPVWAEIDLDALAYNMKNIKSLAEDKEVIAVVKADCYGHGAIDTAPVLLENGASR
LAVAVLTEGIELRKAKITAPIMILGYTPEYLGEELITYDIEQTVYSLEYAQNLSKTALSL
NKKAKIHIALDTGMGRIGFIPNETSLKEVSEICSLPGLDVIGMFTHFSTADEENKDYTLE
QFDKYMNFLHELSKLNISIPLKHVSNSGAIMDMPETFKDLDAVRAGIILYGYYPSHEVKK
ENLSLKPALTIKAKVAHVKEMDENMYISYGRTFKTKRKSIIATIPIGYADGYSRLLIPGA
KVIVNGKLVPIVGRICMDQCMIDVTDAGTVKTGDEVIILGQFENLKINADDYAQILGTIN
YEVLCMFKHRIPKVYIKNNKPVIVRNYI
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatacttagacccgtatgggctgaaatagatttagatgcattagcatacaac
atgaaaaatataaaatcattagctgaagataaagaagtaattgctgttgtaaaagctgat
tgctatggccatggtgccattgatactgctcctgtccttcttgaaaatggagcttcaaga
cttgctgttgcagtattaactgaaggaatagaactcagaaaagctaaaataacagcacct
attatgattctcggatatactcctgaatatttaggagaagagttaataacttacgatatt
gagcaaactgtttatagtcttgaatatgctcaaaatttatcaaaaactgctctttcactt
aataaaaaagctaaaattcatatagcacttgatactggcatgggaagaattggttttatc
ccaaatgaaacttcattaaaagaagtatcagaaatttgctctttaccaggattagatgta
ataggtatgtttacacacttttccactgctgatgaagaaaataaggattatactcttgaa
caatttgataaatacatgaattttttacacgaactttctaagctaaatataagtattccg
ctaaaacacgtttcaaatagtggagcaatcatggatatgcctgaaacatttaaagattta
gatgcggtaagagctggaataatactttatggatattatccttctcatgaagtaaagaaa
gaaaacctttctttaaaaccagcattaacaataaaagcaaaagtagctcatgtaaaagaa
atggatgaaaatatgtatataagctatggcagaacttttaaaactaaaagaaaaagcatt
atagccactattccaataggatatgctgatggatattcacgattactcattcctggagct
aaagtaattgttaatggtaaattagtgcctatagtaggtagaatatgtatggatcaatgt
atgatagatgtaactgatgctggtactgttaaaactggagatgaagttattatcttaggt
caatttgaaaatttaaaaataaatgctgatgattatgctcaaatacttggcacgataaat
tatgaagtgttatgtatgtttaagcacagaattcctaaagtttatataaaaaataataaa
ccagttatcgtacgaaattatatttaa

DBGET integrated database retrieval system