KEGG   Clostridium butyricum: ATN24_05920Help
Entry
ATN24_05920       CDS       T04197                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
cbut  Clostridium butyricum
Pathway
cbut00061  Fatty acid biosynthesis
cbut00620  Pyruvate metabolism
cbut00640  Propanoate metabolism
cbut01100  Metabolic pathways
cbut01110  Biosynthesis of secondary metabolites
cbut01120  Microbial metabolism in diverse environments
cbut01130  Biosynthesis of antibiotics
cbut01200  Carbon metabolism
cbut01212  Fatty acid metabolism
Module
cbut_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:cbut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ATN24_05920
   00640 Propanoate metabolism
    ATN24_05920
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ATN24_05920
Enzymes [BR:cbut01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     ATN24_05920
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     ATN24_05920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RimK GARS_A ATP-grasp_4 ATP-grasp_5 ATPgrasp_Ter Oxidored_nitro ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ALP89686
UniProt: A0A3R9KBQ3
LinkDB All DBs
Position
1:1275103..1276449
Genome map
AA seq 448 aa AA seqDB search
MFKKILIANRGEIAVRIIRACNELGISTVAVYSEADKNSLHVKLADEAYCIGKSSPKDTY
LNINNIINIAVHTKAEAIHPGYGFLSENTSFAKFCEEFNICFIGPHYTIIEKLGDKSNAK
ETMKEASVPIVPGSAGEIKSVDESVKVAEKIGYPVIVKASAGGGGKGMRVAGNKDELITA
IRECEKEADSYFGNSAVYLEKYLNHTRHVEIQIIGDNYGNVVYLGERDCTIQRRHQKLVE
ESPSPALDENLRKRMGEAAVNASKAFKYNSVGTVEFLLNEDNNFYFMEMNTRIQVEHGVT
EMVTGIDLIKEQILVSYGKKLSFSQDDIKVNGCAIECRINAEDPYNNFMPCPGKIDEYIA
SGGIGIRVDSAVYSGYVIPPFYDSMILKLVSWGRNREEAIERMKRALDEFIISGVSTTIP
FHRRLMDNKIFRSGDFNTGFLEDYKILE
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaaagatacttatagctaatagaggagaaattgcagttagaataattcgtgca
tgtaatgaacttgggatttctacagttgcagtatattcagaagctgataaaaattcacta
catgtaaaactggcagatgaagcatactgcattggaaaatcatctcctaaagatacttat
ttaaacataaataatataattaatattgcagttcatacaaaagcagaagctatacatcct
ggatatggatttctttcggaaaatacaagttttgcaaaattttgtgaagaatttaatata
tgtttcataggtccacattatactataatagaaaaattaggagataagtctaatgcaaag
gaaaccatgaaggaagcgagtgtacctattgttccaggaagtgctggtgaaattaaaagt
gtggatgaatcagtaaaagttgctgagaaaataggatatcctgttatagttaaagcatca
gctggaggcggaggaaaaggaatgagagttgcaggtaataaagatgaacttataactgca
ataagggaatgtgaaaaagaagctgatagttattttggaaactctgctgtttatcttgaa
aagtacttaaatcatacgaggcatgttgaaatacaaataataggtgataattacggaaat
gtagtttatttaggggaaagagactgtacaattcaaagacgtcatcaaaaacttgttgag
gagtcaccatcaccagcacttgatgaaaatttaagaaagagaatgggagaggcagcagtc
aatgcatcaaaagcttttaaatataatagtgtgggaactgtagaatttttattaaatgaa
gataataatttttatttcatggaaatgaatacgaggatacaggtggaacatggcgtaact
gaaatggttacaggtatagatttaataaaagaacagatactggtctcttatggaaagaag
ttatctttttcacaagatgatataaaagtcaatggatgtgcaattgaatgcagaataaat
gcagaagatccttacaataattttatgccatgtccagggaaaattgatgaatatatagct
tcgggtgggattggaataagagttgatagtgcagtgtacagtggatatgttatcccgcca
ttttatgattcaatgatattaaaattagtatcatggggaaggaatagagaagaagctatt
gaaaggatgaaaagagcacttgatgaatttattatatctggagtaagtacaacgatacct
tttcatagaagactcatggataataaaatttttagaagtggggattttaatacaggattt
ttagaagattataaaattttagaatag

DBGET integrated database retrieval system