KEGG   Clostridium butyricum: ATN24_05940Help
Entry
ATN24_05940       CDS       T04197                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
cbut  Clostridium butyricum
Pathway
cbut00440  Phosphonate and phosphinate metabolism
cbut01100  Metabolic pathways
cbut01120  Microbial metabolism in diverse environments
cbut01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cbut00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    ATN24_05940
Enzymes [BR:cbut01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     ATN24_05940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like DUF3173 ComA
Motif
Other DBs
NCBI-ProteinID: ALP89690
LinkDB All DBs
Position
1:1280352..1281650
Genome map
AA seq 432 aa AA seqDB search
MAKVYMAMSADIVHQGHLNVINQARNLGDVIVGLHTDDVIRGYWRNPIMKYDERKEVIEN
IKGVIEVIPQDTLDQVSNILKVRPEYVVHGDDWKEGQQKELRENVINALNTYGGKLIEVP
YTKGVSISKLDQDLMEIGITPQMRMKSLKERIYSKKPVRILEAHNGLTGLIVEKTKVEKD
GKVREFDGMWISSLCDSTAKGKPDIELVDLTSRLNTINDILEVTTKPIIVDGDTGGQIEH
FVYTVKTLERLGVSAIIIEDKTGLKKNSLFGTEVKQTQDTIGHFCEKIRAGREARVTSDF
MIISRIESLIAKAGMDDAIKRAEAYIEAGTDGIMIHSKEKDGSEIIEFCEKYAKLERRVP
LIVVPTSYNFMKEEQLVELGVSVIIYANHLIRSAYPAMVNTAKSILENERSKEASENCMP
IKEILTLIPGGK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagtatatatggcaatgagtgctgatattgtgcatcaaggtcatctaaatgta
attaatcaagctagaaatttaggagatgttatcgttggtcttcatactgatgatgttata
agagggtattggagaaatccaataatgaagtatgatgaaagaaaagaagttattgaaaat
ataaaaggagttatagaagttataccacaagatacattggatcaagtatcaaatatatta
aaagtaagaccggagtatgttgtgcatggagatgactggaaggaaggtcaacaaaaagaa
ttaagagagaatgtgattaatgcattaaacacatatggtggaaagcttatagaagttcca
tatacaaaaggagtgtctatttcaaaacttgatcaagatttaatggaaataggaataact
ccacagatgaggatgaaaagtcttaaagaacgtatttattctaaaaaacctgtaagaatt
ttagaagctcataatggtctgactggattgattgtagaaaaaactaaggtagagaaagat
ggaaaggtaagagagtttgatggaatgtggataagctctctttgtgattcaacagctaag
ggaaaacctgatatagaacttgttgatttaacatcacgacttaatacaataaatgatatt
ttagaagtaacaacaaagcctattatagttgatggagatacaggtggacaaatagaacac
tttgtttatacagttaagactcttgagagacttggagtatcggctattattattgaagat
aaaacaggtcttaagaaaaattctctttttggaactgaagtaaagcagacacaagataca
atagggcatttttgtgaaaaaataagagcaggaagagaagcgagagtaacaagtgatttt
atgattatttcaagaatagaaagccttattgcaaaggctggcatggatgatgcaataaaa
agagcagaggcttatattgaagctggaactgatggaatcatgattcatagcaaagaaaaa
gatggaagtgaaattatagaattctgtgaaaaatatgcaaagcttgaaagaagagtacca
cttattgttgtacctacatcatataatttcatgaaggaagaacaacttgttgaattagga
gtaagtgtaataatatacgcaaatcatttaataagaagtgcatatccagcaatggtaaat
acagcaaagagtatattggaaaatgaaagatcaaaagaagcatcagaaaattgtatgcct
ataaaagaaattcttacattaatacctggagggaaatag

DBGET integrated database retrieval system