KEGG   Clostridium baratii: U729_1066Help
Entry
U729_1066         CDS       T03506                                 

Gene name
proC
Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
cbv  Clostridium baratii
Pathway
cbv00330  Arginine and proline metabolism
cbv01100  Metabolic pathways
cbv01110  Biosynthesis of secondary metabolites
cbv01130  Biosynthesis of antibiotics
cbv01230  Biosynthesis of amino acids
Module
cbv_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cbv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    U729_1066 (proC)
Enzymes [BR:cbv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     U729_1066 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 ApbA 3HCDH_N PDH IlvN Rossmann-like Shikimate_DH NAD_Gly3P_dh_N MTD GFO_IDH_MocA Sacchrp_dh_NADP 2-Hacid_dh_C Staph_opine_DH
Motif
Other DBs
NCBI-ProteinID: AIY83616
UniProt: A0A0A7FXP0
LinkDB All DBs
Position
complement(1159921..1160721)
Genome map
AA seq 266 aa AA seqDB search
MSKKIGFVGCGNMGSSMLGGLINKGFQGKENFIVSTRSEGSRKKLEDKYGVKAVLSNIEV
AKESDVLILAVKPYMYKDVIDEIKEALRKDQIIISIAAGIDIKDLTEMIGEGFKIVKTMP
NTPALVGEGMSAICPNDNVSKEELDYVCSLFESFGRYEILNEEDFHGFIALCGSSPAYVF
MFIEAMADSAVKLGIPRNKAYNMAAQSVLGSAKMVLDTGKHPGELKDMVCSPRGTTIEAV
CELENTGFRNSVIKAMDKCAEKSKNM
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaaataggttttgttggatgcggaaatatgggaagttctatgcttggagga
ttaataaataagggttttcaaggtaaagaaaatttcatagtatcaacaagaagtgaaggt
tctagaaaaaaattagaagataaatatggggtaaaagcagttttaagtaatattgaagtt
gcaaaagaaagtgatgttttaatattagctgtaaaaccatacatgtataaagatgttata
gatgaaataaaagaggccttaagaaaagatcaaattataataagtatagcagctgggata
gatattaaagaccttactgaaatgataggagaaggatttaaaatagtaaaaactatgcct
aatactccagcgttagtaggagagggtatgtctgctatatgtcctaatgacaatgtatct
aaagaagaattagactatgtatgtagcttgtttgagtcttttggaagatatgaaatatta
aatgaagaagattttcatggatttatagcattatgtgggtcatcaccagcttatgtattt
atgtttatagaggcaatggcagatagtgcagtaaagcttggaataccaagaaataaagct
tataatatggcagcacaaagtgtgttaggatcagctaagatggtattagatacaggtaag
catccaggagaattaaaagatatggtatgttcacctagaggaactacaatagaagctgta
tgtgagcttgaaaatacaggatttagaaattcagtaataaaagcaatggataaatgtgct
gagaagtcaaaaaacatgtaa

DBGET integrated database retrieval system