KEGG   Clostridium baratii: U729_1455Help
Entry
U729_1455         CDS       T03506                                 

Definition
(GenBank) acyl-CoA reductase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cbv  Clostridium baratii
Pathway
cbv00010  Glycolysis / Gluconeogenesis
cbv00053  Ascorbate and aldarate metabolism
cbv00071  Fatty acid degradation
cbv00280  Valine, leucine and isoleucine degradation
cbv00310  Lysine degradation
cbv00330  Arginine and proline metabolism
cbv00340  Histidine metabolism
cbv00380  Tryptophan metabolism
cbv00410  beta-Alanine metabolism
cbv00561  Glycerolipid metabolism
cbv00620  Pyruvate metabolism
cbv00625  Chloroalkane and chloroalkene degradation
cbv01100  Metabolic pathways
cbv01110  Biosynthesis of secondary metabolites
cbv01120  Microbial metabolism in diverse environments
cbv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cbv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    U729_1455
   00053 Ascorbate and aldarate metabolism
    U729_1455
   00620 Pyruvate metabolism
    U729_1455
  Lipid metabolism
   00071 Fatty acid degradation
    U729_1455
   00561 Glycerolipid metabolism
    U729_1455
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    U729_1455
   00310 Lysine degradation
    U729_1455
   00330 Arginine and proline metabolism
    U729_1455
   00340 Histidine metabolism
    U729_1455
   00380 Tryptophan metabolism
    U729_1455
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    U729_1455
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    U729_1455
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    U729_1455
Enzymes [BR:cbv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     U729_1455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF655
Motif
Other DBs
NCBI-ProteinID: AIY83070
UniProt: A0A0A7FVU9
LinkDB All DBs
Position
1557713..1559089
Genome map
AA seq 458 aa AA seqDB search
MGYLEEVLDEQKKFFRTNKTKDVNFRIEQLKKLKSIIKENEDRILEALKKDLNKSFFEGY
ESEIGIVYEEINYQIKHLRKWTRRKRVSVSIIYFKSKAYIYKEPYGVTLIIGPFNYPFQL
IMAPLIGAIAGGNCAVLKPSEHSKYTSEVLEEIINNEFESNYIKVVEPSGGKEAVTKLLE
LRFDYIFFTGSVKVGKIVMEKASKNLIPVTLELGGKSPCIVDKDANLELSAKRIVWGKLL
NEGQTCIAPDYLMVHKEIKEKFLKLLVEEIKKQFGDNIESNDEYPKIIREAEVLRLKNYL
DDGKIYYGGKYNVENRFMMPTILIDVPLDSKVMTDEIFGPIFPVIEFDSLDNVIEFVNDR
EKPLALYYFSNDDNKVEYILNSISSGGVTINDTIIHVGFCNLPFGGVGNSGIGSYHGKAS
FDTFTHKKSVVKRSNFIEFPFRFAPYKDKLKLLKKVMK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgggttatttagaagaggttttagatgagcaaaagaaattttttagaactaacaaaaca
aaggatgtaaattttagaatagaacaattaaagaaactaaaatcaattataaaagaaaat
gaagatagaatattagaagccttaaagaaagatttgaataaatctttctttgagggttat
gaatcggaaattggaatagtatatgaagaaataaattatcaaataaagcatttaagaaag
tggacaagaagaaaaagggtatcggtatcaattatatattttaaaagtaaggcttatata
tataaagagccatacggagtcacacttataataggtccgtttaattatccatttcaactt
ataatggcaccacttattggagcaatagctggaggaaattgtgctgttttaaaaccatca
gaacattcaaaatatacttctgaagttttagaagaaataataaataatgaatttgaaagt
aattatataaaagtagttgagccatcaggaggaaaagaagcggtaactaagctattggaa
ttaagatttgattatatattctttactggaagtgttaaagttggaaagatagttatggaa
aaagcatctaaaaatttaattccagtaacattagaacttggagggaagagtccttgtatt
gttgataaggatgcaaatttagagttaagtgctaaaagaatagtttggggaaaactttta
aatgaaggacaaacctgtattgcgccagattatttaatggttcataaggagattaaagaa
aagtttttaaagctattagttgaagaaataaaaaaacaatttggagataatatagaaagt
aatgatgaatatccaaaaataataagagaagcagaagttctaagacttaagaattattta
gatgatggaaagatttactatggtggaaaatataatgtggaaaacagatttatgatgcca
actatacttatagatgtacctttagatagcaaagtaatgacagatgaaatatttggacca
atatttcctgtaatagaatttgatagcttagataatgttattgaatttgtaaatgataga
gaaaaaccactagcattatattatttctcaaatgatgataataaggtagagtatatttta
aatagtataagttcaggtggagtaactataaatgatactataatacatgttggattttgt
aatcttccttttggaggagtaggaaatagtggtataggaagttatcatggtaaagcaagc
tttgatacatttactcataaaaagtcagtagttaagaggagcaattttatagaattccca
tttaggtttgcgccttataaagataaattaaagttacttaaaaaagttatgaaataa

DBGET integrated database retrieval system