KEGG   Clostridium baratii: U729_1935Help
Entry
U729_1935         CDS       T03506                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cbv  Clostridium baratii
Pathway
cbv00473  D-Alanine metabolism
cbv01100  Metabolic pathways
cbv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cbv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    U729_1935 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    U729_1935 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbv01011]
    U729_1935 (alr)
Enzymes [BR:cbv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     U729_1935 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cbv01011]
 Precursor biosynthesis
  Racemase
   U729_1935 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C RE_BstXI
Motif
Other DBs
NCBI-ProteinID: AIY84311
UniProt: A0A0A7FZT3
LinkDB All DBs
Position
2030610..2031770
Genome map
AA seq 386 aa AA seqDB search
MEKNLRAVWAEIDLNKIENNMKRIKELAGDREVIAVVKADAYGHGATSVAPVLLKNGASK
LAVAVIAEGIELRDAGIKEPIMILGYTPLELGEDLINYDIEQTVYDLEYAKELSNIAKNL
GKKAKIHIALDTGMGRIGFLPNEESFKDVVEICNLEGLDVCGIFTHFSTADEEDKTYTYE
QFNKMKEFNDKLKEVGINIKLKHASNSGAIIDLPETYLDGVRAGIILYGYYPSNDVNKDR
LKLEPALTLKTRVSHVKTLDKDMYISYGRTFKTERKSVIATLPIGYADGYLRLLSGKAKV
IINGKFANVVGRICMDQCMIDVTDIGDVKVSDEVILLGEEGDLKFNADDIAEAMGTINYE
VLCMIRHRIPRIYKRDNEIVEVRNYL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaatttaagagctgtatgggctgaaatagatttaaataaaatagaaaataat
atgaaaagaataaaagaacttgcaggagatagagaagttattgctgtagttaaagctgac
gcatatggtcatggagcaacaagtgtggcacctgttcttttaaaaaatggtgcatcaaag
cttgctgttgcagtaattgcagaaggtatagaacttagagatgcaggtataaaagagcca
attatgattcttggatacactccattagaacttggagaagatttaattaattatgatata
gaacaaacagtatatgatttagaatatgcgaaagaattatcaaatatagctaaaaattta
ggtaaaaaagcaaaaattcatatagcattggatactggaatgggtagaataggattttta
ccaaatgaagaaagttttaaagatgtagtggaaatatgtaatttagagggcttagatgta
tgtggaatattcactcatttttctactgcggatgaagaagataaaacttacacttatgag
caattcaataaaatgaaagaatttaatgataaacttaaagaagtaggaataaatattaaa
ttaaaacatgcatcaaatagtggagctataatagatcttccagaaacttatttagatgga
gttagagctggtataatattatatggatactacccatcaaatgacgttaataaagataga
cttaaattagagccagcacttacattaaaaactagagtatctcatgttaaaacattagat
aaagatatgtatattagttatggaagaacttttaaaactgaaagaaagagtgtaatcgca
acacttccaattggatatgcagatggatatttaagacttttaagtggaaaagctaaggtt
attataaatggtaagtttgcaaatgttgtaggaagaatatgcatggatcaatgtatgata
gatgtaacagatattggagatgttaaagtttctgatgaagttatacttcttggagaagag
ggagatttaaaatttaatgcagatgatattgcagaagctatgggtacaataaattatgaa
gttctatgtatgataagacatagaattccaagaatatataaaagagataatgaaattgta
gaagttagaaattatctttag

DBGET integrated database retrieval system