KEGG   Clostridium baratii: U729_925Help
Entry
U729_925          CDS       T03506                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cbv  Clostridium baratii
Pathway
cbv00250  Alanine, aspartate and glutamate metabolism
cbv00410  beta-Alanine metabolism
cbv00430  Taurine and hypotaurine metabolism
cbv00650  Butanoate metabolism
cbv01100  Metabolic pathways
cbv01110  Biosynthesis of secondary metabolites
cbv01120  Microbial metabolism in diverse environments
cbv02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cbv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    U729_925
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    U729_925
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    U729_925
   00430 Taurine and hypotaurine metabolism
    U729_925
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    U729_925
Enzymes [BR:cbv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     U729_925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AIY83613
UniProt: A0A0A7FVJ5
LinkDB All DBs
Position
complement(1021732..1023135)
Genome map
AA seq 467 aa AA seqDB search
MLFTKENKIGNDTYKTPVFGALEEDVDLPKYKLAKDPVEPRIAYRLVKDQLMDEGNARLN
LATFCQTYMEDEATKLMSETLEKNAIDKSEYPQTTELENRCVNIIADLWHAPENMNYLGT
STVGSSEACMLGGMAMKFRWRNRAKALGMDVNNRKPNLVVSSGFQVCWEKFCVYWDIEMR
LVPLDEEHMSLDVDKVLDYVDDYTIGVVGILGITYTGKYDDIKKLDAVLEEYNKTAKISV
PIHVDAASGGLFAPFIEPDLEWDFRLKNVVSISTSGHKYGLVYPGIGWVMWKDEEYLPKE
LIFEVSYLGGQLPTMAINFSRSASQIIGQYYNFLRYGFEGYRRIHQRTKDVAMYLSKEIE
NMGLFEIYNDGENLPIVCFKLKDDANVNWTSYDLADRLAMKGWQVPAYPLPENLQDTTIQ
RIVCRADLGHSMAEQLIADMKTGIEDLNKATLLCHGKETKGKYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgttattcacaaaggaaaataaaataggaaatgacacttacaaaacaccagtatttgga
gcattagaagaagatgtagatttaccaaaatataagttagctaaggatccagtagaacca
agaatagcttacagattagtaaaagaccaattaatggatgaaggtaacgctagattaaac
ttagcaacattctgccaaacttacatggaagatgaagctacaaaattaatgtcagaaact
ttagaaaagaatgcaatagataaatcagaatatcctcaaactactgaactcgagaaccgt
tgtgtaaatattattgctgatttatggcatgcaccagaaaatatgaattatcttggaact
tcaacagttggatcatcagaagcttgtatgctaggtggtatggcaatgaaattcagatgg
agaaacagagcaaaagctttaggaatggatgttaacaatagaaaaccaaacttagtagtt
tcatcaggattccaagtttgttgggaaaaattctgtgtatactgggatatcgaaatgaga
ttagttccattagatgaagaacacatgagcttagacgtagataaagttttagactatgtt
gatgattacacaatcggtgtagttggtatacttggtataacttacactggtaaatatgat
gacattaagaaattagatgcagtattagaagaatacaataagactgcaaaaatctcagtt
ccaattcacgtagatgctgcttcaggtggattatttgcaccatttattgaaccagatctt
gaatgggacttcagattaaagaatgtagtatcaatcagtacttcaggtcataaatatgga
ctagtttacccaggaatcggttgggttatgtggaaagacgaagaatacttaccaaaagaa
ttaatatttgaagtaagctacttaggtggacaattacctacaatggcaatcaacttctca
agaagtgcaagccaaataattggacaatattacaatttcttaagatatggattcgaagga
tacagaagaatacatcaaagaacaaaagatgttgcaatgtatttatcaaaagaaatagaa
aatatgggcttatttgaaatatacaatgatggtgaaaacttaccaatagtatgcttcaaa
ttaaaagatgatgctaatgtaaattggacatcatatgatttagctgatagattagcaatg
aaaggatggcaagtacctgcttatccattaccagaaaatttacaagatacaactatccaa
cgtatcgtttgtcgtgcagacttaggacacagcatggctgaacaattaatagctgatatg
aagactggtatagaagatcttaataaagctactttattatgccatggaaaagaaactaaa
ggaaaatatggattcactcactag

DBGET integrated database retrieval system