KEGG   Cupriavidus basilensis: RR42_m0666Help
Entry
RR42_m0666        CDS       T03642                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
cbw  Cupriavidus basilensis
Pathway
cbw00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cbw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RR42_m0666
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cbw01002]
    RR42_m0666
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbw01011]
    RR42_m0666
Enzymes [BR:cbw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     RR42_m0666
   3.4.21  Serine endopeptidases
    3.4.21.-  
     RR42_m0666
Peptidases [BR:cbw01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   RR42_m0666
Peptidoglycan biosynthesis and degradation proteins [BR:cbw01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   RR42_m0666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AJG18078
UniProt: A0A0C4Y5D1
LinkDB All DBs
Position
main:complement(719185..720717)
Genome map
AA seq 510 aa AA seqDB search
MGIMPNRPSPILHRLLPLCAAGLLCISGVSTAAKTPVHKTKATHAASASAEPRSGLPGSV
TAALKRAHVPASATSFYVIKVGAPAPRASWNAQTPMNPASTMKLVTTFAGLQLLGPGYRW
QTALYADNQPAADGTVNGNVYLRGYGDPKLVPEEMAKLVNSARTAGATTINGDVVLDRSY
FDSALDKGATIDGETQRAYNVSPDALLYAFKTLSFTITPDPANQSVAVSVTPALAQLKLD
NRLALSHGKCGDWSARARPAVTPQADGTVLASFDGSYAADCGEHVVNIATLSHNEFTWGG
FVAEWQLAGGRFTHQPALRMGRAPRNAFLLARHYGQPLSEIVRDINKFSNNVMARQLYLT
IGAEMDRSGPASTTRSAKVVQRWLARQGLDMPGLALDNGSGLSREERISAYDMSRLLQQA
LASEVGPVLIDSLPILGVDGTLRNRLTHAGAAGNAYMKTGTLNDVRALAGYVDALNGDRY
VVVSYINHANAAQAREAHDALLQWVYQGAP
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcatgccgaatcgcccatccccaattcttcaccgcctgctgccgctttgcgcc
gccgggctgctttgcatcagcggcgtgagtaccgccgccaagacccccgttcacaagacc
aaggccacccacgccgcgtccgcgtccgccgagccgcgctccggcttgccgggcagcgta
acggccgcgctcaagcgcgcgcatgtgcccgcctcggccaccagcttctacgtgatcaag
gtcggcgcgccggcgccccgcgcaagctggaacgcgcaaacgccgatgaacccggcttcc
accatgaagctggtcaccaccttcgccgggctccagctgcttggccccggctaccgctgg
cagaccgcgctgtacgccgacaaccagccagcagccgatggcaccgtcaacggcaacgtc
tacctgcgtggctatggcgaccccaagctggtgccggaagaaatggccaagctggtcaac
agtgcccgcaccgcaggcgccaccaccatcaatggcgacgtggtgctggaccgcagctac
ttcgattccgccctcgacaagggcgccaccatcgatggcgaaacccagcgcgcctacaac
gtcagccccgacgcgctgctctacgccttcaagacgctgtcgtttaccatcacgcccgat
ccggccaaccagtcggtcgcggtgtcggtcacgcccgcgctggcgcagctcaagctcgac
aaccgcctggcactgtcccacggcaaatgcggcgactggtcggcacgcgcccgccccgcc
gtcacgccacaggccgacggcaccgtgctggcctccttcgacggcagctacgccgccgac
tgcggcgaacacgtggtcaacatcgccacgctctcgcacaacgaattcacctggggtggc
tttgtcgccgaatggcaactggccggcggccgcttcacccaccagccagccctgcgcatg
ggccgcgccccgcgcaacgccttcctgctggcacgccactacggccagcccctgtcggaa
atcgtgcgcgacatcaacaagttctcgaacaatgtgatggcccgccagctttacctgacc
attggcgcggagatggatcgcagcggcccggccagcaccacccgctcggccaaggtggtg
cagcgctggctggcgcgccaggggctggacatgcctggcctggcactcgacaacggctcc
ggactatcgcgcgaagaacgcatcagtgcctacgatatgtcgcggctgctgcagcaagcg
ctggccagtgaagtcggcccggtgctgatcgattcgctgccgatcctcggcgtggacggc
acgctgcgcaaccgcctgacgcacgccggcgcggccggcaatgcctacatgaagacagga
acgttgaacgacgtccgcgcgctggccggctatgtcgacgcgctgaacggcgaccgctat
gtggtggtcagctacatcaaccacgccaacgcagcacaagcccgcgaagcccacgacgcc
ctgttgcaatgggtgtatcagggcgcaccctga

DBGET integrated database retrieval system