KEGG   Cupriavidus basilensis: RR42_m0787Help
Entry
RR42_m0787        CDS       T03642                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cbw  Cupriavidus basilensis
Pathway
cbw00061  Fatty acid biosynthesis
cbw00780  Biotin metabolism
cbw01100  Metabolic pathways
cbw01130  Biosynthesis of antibiotics
cbw01212  Fatty acid metabolism
Module
cbw_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cbw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RR42_m0787
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RR42_m0787
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    RR42_m0787
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cbw01004]
    RR42_m0787
Enzymes [BR:cbw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     RR42_m0787
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     RR42_m0787
Lipid biosynthesis proteins [BR:cbw01004]
 Fatty acid synthase
  Component type
   RR42_m0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AJG18199
UniProt: A0A0C4Y7T0
LinkDB All DBs
Position
main:843362..844117
Genome map
AA seq 251 aa AA seqDB search
MLGARVLVVGVANAESIAWGCARAFRELGAELAITYLNEKAYPHVAPLAESVGATILMPL
DVEDAGQEQALFERITRQWGQLDVLVHSVAFAPKDDLQGGLLNASAAGFARAMDVSCHSF
VRLARRAVPLMREGGSLFAMSYEGANRVVPNYNLMGPVKAALEASCRYLAHELGPSGIRV
HAISPGPLKTRAASGLKDFEQLLADAAGRAPLGELVDIMDVGFATAYLATPYARRISGNT
VYVDGGAHIMG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
ttgctgggcgcgcgcgtgctggtggtcggcgtggccaacgcggagtccatcgcgtggggc
tgcgcgcgggccttccgcgagcttggcgctgaactggcaatcacctatctcaacgaaaag
gcctacccgcatgtggcgccgctggctgaatcggtgggcgcgacgatcctgatgccgctc
gacgtggaggacgcgggccaggagcaggcgctgttcgagcggatcacccggcaatggggc
cagctcgacgtgctggtgcactcggtggccttcgcgcccaaggacgacttgcagggcggg
ctgctcaatgcgtcggcggccggcttcgcgcgcgccatggacgtgtcctgccattccttc
gtgcgcctggcgcggcgcgcggtgccgctgatgcgcgagggcggcagcctgttcgccatg
agttacgagggcgccaaccgcgtggtgccgaactacaacctgatgggcccggtcaaggcg
gcgctggaggcctcctgccgctacctggcgcacgagctcggcccgagcggcatccgcgtg
cacgccatttcgccggggccgctcaagacccgcgcggcgtccgggctcaaggatttcgag
caattgctggcggatgccgcgggccgtgccccgctgggcgagctggtcgacatcatggat
gtcggttttgccaccgcctacctggcgacgccctacgcgcgccggatttccggcaacacc
gtgtacgtggacggcggcgcgcacatcatgggctga

DBGET integrated database retrieval system