KEGG   Cupriavidus basilensis: RR42_m1192Help
Entry
RR42_m1192        CDS       T03642                                 

Definition
(GenBank) Glutathione S-transferase N-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cbw  Cupriavidus basilensis
Pathway
cbw00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cbw00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RR42_m1192
Enzymes [BR:cbw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RR42_m1192
Transporters [BR:cbw02000]
 Other Transporters
  Pores ion channels [TC:1]
   RR42_m1192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C_2 GST_C GST_C_3 GST_N GST_N_2
Motif
Other DBs
NCBI-ProteinID: AJG18598
UniProt: A0A0C4Y6R2
LinkDB All DBs
Position
main:1268805..1269446
Genome map
AA seq 213 aa AA seqDB search
MLKLCGFAASNYYNKVKLALLEKNLPFEEELAWIGKTDLDATPLGKVPYMITDHGPLCES
EVLDAYIEATYPQAPLLPASPYEAAKVRELVTFLELYLELTVRELYPEAFFGGKVSDGVK
ERQKKLLERYIPAFAKLAKFSPYLAGDTFTLADCAAVVHFPLISSCTKIIYGTDMLADLP
VKEYLKRMSERPTVQKVNEDRKANTELMLSGRK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagctctgtggttttgccgccagcaactactacaacaaggtcaagctggccttg
ctggaaaagaacctgcccttcgaggaggagctggcctggatcggcaagaccgatctcgac
gccacgcccctgggcaaggtgccctacatgatcaccgatcacggcccgctatgcgagtcc
gaagtactggacgcctacatcgaggcgacctacccgcaagcgccgctgctgcccgccagc
ccctacgaggcggccaaggtgcgcgaactggtgactttcctggagctgtacctggagctg
accgtgcgcgagctttaccctgaagcgtttttcggcggcaaggtcagcgacggcgtcaag
gaacgccagaaaaagctgctggagcgctatatccccgccttcgccaagctggcgaagttc
tcgccctacctggcgggcgacacctttacgctggcggactgcgccgcggtggtgcacttt
ccgctgatctcgtcttgcaccaagatcatctacggcacggacatgctggccgacctgccg
gtcaaggagtacctcaagcgcatgtcggagcgcccgacggtgcagaaggtgaatgaggat
cgcaaggcgaataccgagctgatgctgagcggccggaagtaa

DBGET integrated database retrieval system