KEGG   Cupriavidus basilensis: RR42_m1893Help
Entry
RR42_m1893        CDS       T03642                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase, R-alcohol forming, (R)- and (S)-acetoin-specific
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cbw  Cupriavidus basilensis
Pathway
cbw00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cbw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    RR42_m1893
Enzymes [BR:cbw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     RR42_m1893
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     RR42_m1893
    1.1.1.-  
     RR42_m1893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc AlaDh_PNT_C 2-Hacid_dh_C DAO
Motif
Other DBs
NCBI-ProteinID: AJG19288
UniProt: A0A0C4Y8L0
LinkDB All DBs
Position
main:complement(1993249..1994355)
Genome map
AA seq 368 aa AA seqDB search
MSNEGSVHQSSMKAAVWRGRHDVRVEEVRVPDKPAEGWVKIRVHWCGICGSDLHEYVAGP
VFIPVDHPHPLTGLKGQCILGHEFSGEIAELGAGVTGFKVGERVTADACQHCGKCYYCTH
GLYNICESLAFTGLMNNGAFAEYVNVPAELLYKLPENFPTEAGALIEPLAVGLHAVKKAG
NIVGQTVVVVGAGTIGLCTIMCAKAAGAGRIIALEMSSARKKKALEVGANVVIDPKECDA
IAQVKALTGGYGADVSFECIGNKATAKLAIDVIRKAGKCVMVGIFEEPSAFNFFEIVSTE
KEIIGSLAYNGEFADVIRFIADGRIDVQPLITGRISLADIVSQGFEELVNNKDGNVKIIV
QPVASLAA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaacgaaggttcggtacatcagtccagcatgaaggccgccgtatggcggggtcgc
cacgatgtccgcgtcgaggaggtacgcgtcccggacaagcccgccgaaggatgggtaaag
atccgcgtgcattggtgcggcatctgcgggtcggacctgcatgaatatgtcgcgggcccg
gtctttatcccggtcgaccacccccacccgctcaccggtctgaaggggcaatgcatcttg
ggccacgagttcagtggcgagatcgcggaactgggcgcgggcgtgaccggtttcaaggtc
ggcgaacgcgtcaccgcggatgcctgccagcattgcggaaaatgctattactgcacccat
ggcctgtacaacatctgcgagagtctcgcgttcaccggcctgatgaacaacggcgcattc
gcggaatacgtcaacgtaccggcggagctgctctacaagctgccggagaacttccccacc
gaggcgggggcactgatcgaaccgctggcggtagggcttcatgccgtgaagaaagccggc
aacatcgtcggccagacggttgtggtggttggcgccggcaccatcggcctgtgcacgatc
atgtgcgcgaaggcggccggcgcaggccgcatcatcgcgctcgaaatgtcgtcggcgcgc
aagaagaaggcgctggaggttggcgccaacgtcgtcatcgatcccaaggaatgcgacgcg
atcgcgcaggtcaaggcactgaccggcggctatggcgcggatgtgtccttcgagtgcatc
ggcaacaaggccacggcgaagcttgccatcgacgtgatccgcaaggccgggaaatgcgtg
atggtgggcatcttcgaagagcccagcgcattcaatttcttcgagatcgtatcgacggag
aaggaaatcatcggatcgctcgcctataacggcgaattcgccgacgtgatccgctttatc
gccgatggccgcatcgacgtgcagccgctcatcaccggacggatctccctcgccgacatt
gtgtcgcaaggcttcgaagaactcgtcaacaacaaggatggcaacgtcaagatcatcgtc
cagccggttgccagcctggcagcctga

DBGET integrated database retrieval system