KEGG   Cupriavidus basilensis: RR42_m2620Help
Entry
RR42_m2620        CDS       T03642                                 

Definition
(GenBank) Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cbw  Cupriavidus basilensis
Pathway
cbw00020  Citrate cycle (TCA cycle)
cbw00310  Lysine degradation
cbw00380  Tryptophan metabolism
cbw01100  Metabolic pathways
cbw01110  Biosynthesis of secondary metabolites
cbw01120  Microbial metabolism in diverse environments
cbw01130  Biosynthesis of antibiotics
cbw01200  Carbon metabolism
Module
cbw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cbw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cbw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RR42_m2620
  09105 Amino acid metabolism
   00310 Lysine degradation
    RR42_m2620
   00380 Tryptophan metabolism
    RR42_m2620
Enzymes [BR:cbw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RR42_m2620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF5401
Motif
Other DBs
NCBI-ProteinID: AJG20006
UniProt: A0A0C4YH23
LinkDB All DBs
Position
main:complement(2780974..2782221)
Genome map
AA seq 415 aa AA seqDB search
MAIVDVKVPQLSESVAEATMLNWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLSQI
IRNDGDTVVADEVIAKIDTEATAGAVAPAAAAPAPAAPAAAAAPAAAGAVAMPSAAKLMA
EGGLSAGQVAGTGKDGRITKGDVLAATAAPAPAPAAKAAPAPAAAKPALQQVAAPMDFAA
LGDRPEERVPMSRLRARIAERLLQSQSTNAILTTFNEVNMKPVMDLRNKYKDRFEKEHGV
KLGFMSFFVKAAVHALKKFPLINASIDGNDIVYHGYFDIGIAVGSPRGLVVPILRNADQM
SLADIEKKIAEFGAKARDGKLSLEELTGGTFSISNGGTFGSMLSTPIINPPQSAILGVHA
TKDRPVVEDGQIVIRPMNYLAMSYDHRIIDGREAVLGLVAMKDALEDPARLLLDL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggctattgttgacgtcaaggttccgcaactctctgaatcggttgcagaagcaaccatg
ctgaactggaagaagaagccgggcgaagctgttgcccaagacgaaatcctgatcgaaatc
gagaccgacaaagtcgtgctcgaagtgcccgccccgtcggctggcgtgctgtcgcagatc
atccgcaacgacggcgacaccgtggttgccgacgaagtgatcgccaagatcgacaccgaa
gccaccgctggcgccgtcgctcccgccgctgccgcaccggcacccgctgccccggccgca
gcagccgctccggcagcagccggcgccgtggccatgccttcggcagccaagctgatggcc
gaaggcggactgtccgccggccaggttgcaggcacgggcaaggatggccgcatcaccaag
ggtgacgtgctggccgcgaccgctgctcccgctcccgcaccggccgccaaggcagcaccg
gctccggccgctgccaagccggcgctgcagcaggttgccgccccgatggacttcgccgca
ctgggcgaccgcccggaagaacgcgtgccgatgagccgcctgcgtgcccgtatcgccgag
cgcctgctgcaatcgcaaagcaccaacgccatcctcaccacgttcaatgaagtgaacatg
aagccggtgatggacctgcgtaacaagtacaaggaccgcttcgagaaggaacacggtgtg
aagctgggcttcatgtccttcttcgtcaaggccgcggttcacgcgctgaagaaattcccg
ctgatcaacgcatcgatcgacggcaacgacatcgtctatcacggctacttcgacatcggt
atcgcggtgggctcgccccgtggcctggtggtgcctatcctgcgcaacgccgaccagatg
agcctggccgacatcgagaagaagattgctgaattcggcgccaaggcccgcgacggcaag
ttgtcgctggaagagctgaccggtggcacgttctcgatctccaacggtggcaccttcggc
tcgatgctgtcgacgccgatcatcaacccgccgcaatccgcgatcctgggcgtgcacgcc
accaaggaccgcccggtggtggaagacggccagatcgtgattcgtccgatgaactacctc
gccatgtcctacgaccaccgcatcatcgacggccgcgaagccgtcctgggcctggtcgcc
atgaaggacgcgctggaagatccggcacgcctgctgctggacctgtaa

DBGET integrated database retrieval system