KEGG   Cupriavidus basilensis: RR42_m2805Help
Entry
RR42_m2805        CDS       T03642                                 

Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cbw  Cupriavidus basilensis
Pathway
cbw00564  Glycerophospholipid metabolism
cbw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    RR42_m2805
Enzymes [BR:cbw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RR42_m2805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 HI0933_like Pyr_redox_2 GIDA NAD_binding_8 FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AJG20184
UniProt: A0A0C4YDP1
LinkDB All DBs
Position
main:2981046..2982650
Genome map
AA seq 534 aa AA seqDB search
MQTLHTPILPPERATLLATLEREPKWDVIVIGGGATGLGTAVDAASRGYRTLLVEAADFA
KGTSSKATKLVHGGVRYLAQGNISLVREALHERGLLARNAPHLVWPLGFVVPAYQLFDQP
FYGIGLKLYDMLAGGLNLSGSRWLNHRETLAAAPTLAEHVGGRPLRGGNLYFDGQFDDAR
LAIALMRTLFDVGGTAINYLRVSGLSQRNGVIDGVTVQDVLGDASFDLKASCVINATGVW
VDAVRQMEDGQARSMVAPSQGVHLTLPRSFLPGDRAILIPKTDDGRVLFVVPWNGHTIIG
TTDTPRKDLPLEPRAGADDVDFILETATRYLSRAPTRADVTSVWAGLRPLVKATGEASTA
SLSREHTILVSKAGLITVTGGKWTTYRKMAEDVVGTAIQRQMLPAAPCVTADLPLHGAQG
LPANLPAPGSGSPDRYYGNEAGMLHTLPGNDEMLVPGAGLTAAHVRFAARFELARRVEDV
LARRNRALFLEASAASAAAPRVAEILAEEHGHDAAWQAAEVASFRELASGYMLA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcagacactgcacacccccatcctgccgcccgagcgcgccaccctgctcgccaccctc
gagcgcgagccgaagtgggatgtcatcgtcatcggcggcggcgccaccggcctgggcacg
gcggtggacgccgcctcgcgcggctaccgcacgctgctggtggaagccgccgacttcgcc
aagggcacctccagcaaggccaccaagctggttcacggcggcgtgcgctacctcgcgcag
ggcaatatcagcctggtgcgcgaggcgctgcatgagcgtggcctgctagcccgcaacgcg
ccgcacctggtgtggccgctcggcttcgtggtgccggcctaccagttgttcgaccagccc
ttctacggcatcggcctgaagctatacgacatgctggccggcggcctcaacctgtccggc
agccgctggctcaaccaccgcgaaaccctggcggcggcgccgaccctggccgagcacgtg
ggcgggcggcccctgcgcggcggcaacctgtatttcgacgggcagttcgacgatgcccgc
ctggccatcgcgctgatgcgcacgctgttcgacgtaggcggcacggccatcaactacctg
cgcgtgagcgggctgtcgcagcgcaacggggtaatcgacggcgttaccgtgcaggacgtg
ctgggcgacgccagcttcgacctgaaggcgtcctgcgtgatcaacgccaccggcgtgtgg
gtcgatgccgtgcgccagatggaagacggccaggcccgcagcatggtggcccccagccag
ggcgtgcacctgaccttgccgcgcagcttcctgcccggcgaccgtgccatcctgatcccc
aagaccgatgacggccgtgtgctcttcgtcgtaccctggaacggccacaccatcatcggc
accaccgacaccccacgcaaggacctgccgctggagccgcgcgccggtgccgacgatgtc
gatttcatcctggagaccgccacgcgctacctgtcgcgcgcgccaacccgcgccgatgtg
accagcgtctgggccggcctgcgcccgctggtcaaggccaccggcgaagcctccaccgcc
tcgctctcgcgcgagcacaccatcctggtatccaaggccggcctgatcaccgtcaccggc
ggcaagtggaccacctaccgcaagatggccgaggacgtggtgggcacggccatccagcgc
cagatgctgccggccgcgccctgcgtgacggcggatctgccgctgcacggcgcgcaaggc
ttgcccgctaacctgcccgcgcccggcagcggctcgccggaccgttactacggcaacgag
gccggcatgctgcacacgctgcccggcaacgacgaaatgctggtgcccggcgccgggctg
accgccgcccatgtgcgctttgccgctcgcttcgaactggctcggcgagtcgaggacgtg
ctggcgcgacgcaatcgcgccctgttcctggaagccagcgccgcgagcgcggcagcgccg
cgggtggccgagatcctggccgaggagcacgggcacgacgccgcctggcaagcggccgag
gtagccagcttccgcgagctagcaagcggctatatgctggcgtga

DBGET integrated database retrieval system