KEGG   Cupriavidus basilensis: RR42_m3918Help
Entry
RR42_m3918        CDS       T03642                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cbw  Cupriavidus basilensis
Brite
KEGG Orthology (KO) [BR:cbw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cbw03012]
    RR42_m3918
   03029 Mitochondrial biogenesis [BR:cbw03029]
    RR42_m3918
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbw04147]
    RR42_m3918
Translation factors [BR:cbw03012]
 Eukaryotic Type
  Elongation factors
   RR42_m3918
 Prokaryotic Type
   RR42_m3918
Mitochondrial biogenesis [BR:cbw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RR42_m3918
Exosome [BR:cbw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RR42_m3918
  Exosomal proteins of breast cancer cells
   RR42_m3918
  Exosomal proteins of colorectal cancer cells
   RR42_m3918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: AJG21277
UniProt: A0A0C4YKX3
LinkDB All DBs
Position
main:complement(4164101..4165291)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFSRTKPHVNVGTIGHVDHGKTTLTAAIATVLAAKFGGSAKKYDEIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYEFPGDDTPIIKGSAKLALE
GDKGELGEQAILALAEQLDSYIPTPERAIDGTFLMPVEDVFSISGRGTVVTGRIERGIIK
VGEEIEIVGIKPTVKTICTGVEMFRKLLDQGQAGDNVGLLLRGTKREDVERGQVLCKPGS
IKPHTHFTGEVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKILD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaaagttctcgcggactaaaccgcacgtgaacgttggtacgatcggtcac
gttgaccatggtaagaccaccctgacggcagcaattgctacggtgctggcagccaagttt
ggcggttcggccaagaagtacgacgaaatcgacgcagcgccggaagaaaaggcacgcggt
attaccatcaacaccgcacacgtcgagtacgaaacggctaaccgccactacgcacacgtt
gactgcccgggccacgctgactatgtgaagaacatgatcacgggcgccgcacagatggac
ggcgcgatcctggtgtgctcggccgctgacggcccgatgccccagacccgcgaacacatc
ctgctggcccgccaggttggcgtgccttacatcatcgtgttcctgaacaagtgcgacatg
gtcgacgacgccgagctgctcgagctggtcgaaatggaagtgcgcgagctcttgtccaag
tacgaattccccggcgacgacaccccgatcatcaagggttcggccaagctggcactggaa
ggcgacaagggcgaactgggcgagcaagccattctggccctggccgagcagctggacagc
tacatcccgacgccggaacgtgccatcgacggtaccttcctgatgccggtggaagacgtg
ttctcgatctcgggccgtggcacggttgtgaccggtcgtatcgagcgcggcatcatcaag
gttggtgaagaaatcgaaatcgttggtatcaagccgacggtcaagaccatctgcaccggc
gtggaaatgttccgcaagctgctggaccaaggtcaagcaggcgacaacgtgggtctgctg
ctgcgcggcacgaagcgcgaagacgtcgagcgcggccaagtgctgtgcaagccgggttcg
atcaagccgcacacgcatttcaccggcgaggtctacatcttgtcgaaggatgaaggcggc
cgccacaccccgttcttcaacaactaccgcccgcagttctacttccgtacgaccgacgtg
actggctcgatcgagctgccgaaggacaaggaaatggttatgccgggtgacaacgtgtcg
atcacggtcaagctgattgccccgatcgccatggaagaaggcctgcgtttcgctatccgt
gaaggcggtcgtaccgtcggcgccggcgtcgtggcaaagatcctcgactaa

DBGET integrated database retrieval system