KEGG   Cupriavidus basilensis: RR42_s0339Help
Entry
RR42_s0339        CDS       T03642                                 

Definition
(GenBank) Phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
cbw  Cupriavidus basilensis
Pathway
cbw00440  Phosphonate and phosphinate metabolism
cbw01100  Metabolic pathways
cbw01120  Microbial metabolism in diverse environments
cbw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cbw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    RR42_s0339
Enzymes [BR:cbw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     RR42_s0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 NTP_transferase IspD ICL
Motif
Other DBs
NCBI-ProteinID: AJG21935
UniProt: A0A0C4YGU4
LinkDB All DBs
Position
secondary:371078..372784
Genome map
AA seq 568 aa AA seqDB search
MNAIDPIFSTASRSARLRQMIVGNELEFMMEAHNGLSARIVREAGFKAIWASGLAISAQY
GVRDNNEASWTQVVDTLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDDNFSIVARVEALIAGWGMDEALR
RAEAYRQAGADAILIHSKLSRPDEILQFAREWAGRGPLVIVPTKYYSTPTEAFRKAGISV
VIWANHLIRVAASSMQAVAKEIHDSETLVNVEDRIATVNEIFRLQDADEYSTAEKIYLSG
SQAPGAAVVLAAGRGTGLEPLTEDRPKVMLPVAGKPLLRWLVDAFKKQSINDITVVGGYQ
AKAIDTAGIKLVVNEQYAQTGELASLACAVDGLQTDTVIAYGDLLFRSYILRDLLESDAP
FSVVVDSSLTTESNQSVRDFAYCSAPDDRDLFGQKILLRHVSSKGQEPGAGQAQAPHGRW
IGLLNVRGEGRVRLQKLVAELRKRDDFNTLDMPALLNALVEAGEQIEVKYVHGHWRGVND
LDDFRRAGDFAHTQTPFAVGGTDAEEAR
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcgattgacccgattttttcgaccgcttcgcgcagcgcccggctgcgccagatg
attgtcggcaacgagctggaattcatgatggaagcccacaacgggctgtccgcgcgcatc
gtgcgcgaggccggtttcaaggccatctgggcttcgggcctggcgatctccgcccagtac
ggcgtgcgcgacaacaacgaagcgagctggacccaggtggtcgatacgctggagttcatg
gccgacgccagcgacctgccgatcctgctggacggcgacaccggctacggcaacttcaac
aatgtgcgccgcctggtgcgcaagctcgagcagcgcggtattgccggtgtgtgcatcgag
gacaagcagtttcccaagaccaacagcttcatcgacggcgagcgccagccgctggccgag
atcgatgagttctgcggcaagatcaaggccggcaaggattcgcagtcggacgacaacttc
tccatcgtcgcccgcgtggaagccttgatcgcaggctggggcatggacgaagccctgcgc
cgcgccgaggcctatcgccaggccggcgccgatgccatcctgatccacagcaagctgtcg
cgcccggacgagatcctgcagttcgcgcgcgagtgggccggccggggcccgctggtgatc
gtgccgaccaagtactacagcaccccgaccgaagccttccgcaaggccggcatcagcgtg
gtgatctgggccaaccacctgatccgcgtggcggcatcctcgatgcaggccgtggccaag
gagattcacgacagcgagacgctggtcaatgtggaagaccgcatcgccaccgtcaacgag
atcttccgcctgcaggacgccgacgagtactcgaccgccgagaagatctacctgtccggc
tcgcaagcgccgggcgcggcggtggtgctggcggccggccgcggcaccggcctggagccc
ctcaccgaggaccgtcccaaggtcatgctgcccgtggccggcaagccgctgctgcgctgg
ctggtggacgcgttcaagaagcagtcgatcaacgacatcaccgtggtgggcggctaccag
gccaaggccatcgacacggccggcatcaagctggtggtcaacgagcagtacgcccagacc
ggcgagctggcctcgctggcgtgtgccgttgacggattgcagacggataccgtgatcgcc
tacggcgacctgctgtttcgcagctatatcctgcgcgacctgctcgagagcgacgcgccg
ttcagcgtagtggtggactcgtcgctgaccacggagtcgaaccagagcgtgcgcgacttc
gcctattgctccgcgcccgacgaccgcgacctgttcggccagaagatcctgctgcgccat
gtgtcgagcaagggccaggagccgggcgcaggtcaggcccaggcaccgcacggccgctgg
atcggcctgctgaacgtgcgcggcgagggccgcgtgcgcctgcagaagctggttgccgaa
ctgcgcaagcgcgacgacttcaacacgctggacatgcccgcgctgcttaacgcgctggtc
gaagccggtgaacagatcgaagtgaagtatgtgcacggccactggcgcggcgtgaacgac
ctcgacgacttccgccgcgcgggcgatttcgcgcatacgcagacaccgtttgcggtcggc
ggcacggacgcagaggaagcccgatga

DBGET integrated database retrieval system