KEGG   Cupriavidus basilensis: RR42_s0604
Entry
RR42_s0604        CDS       T03642                                 

Definition
(GenBank) Enoyl-CoA hydratase
  KO
K07534  cyclohex-1-ene-1-carboxyl-CoA hydratase [EC:4.2.1.-]
Organism
cbw  Cupriavidus basilensis
Pathway
cbw00362  Benzoate degradation
cbw01100  Metabolic pathways
cbw01120  Microbial metabolism in diverse environments
cbw01220  Degradation of aromatic compounds
Module
cbw_M00540  Benzoate degradation, cyclohexanecarboxylic acid =>pimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:cbw00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RR42_s0604
Enzymes [BR:cbw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     RR42_s0604
SSDB
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 SDH_sah
Other DBs
NCBI-ProteinID: AJG22197
UniProt: A0A0C4Y9P7
LinkDB
Position
secondary:645864..646667
AA seq 267 aa
MTAHEATPAIDENLVLLEMVGRVAVIRLNRPRQMNALNDALMDALGLALLACEQDDGVGA
IVITGNDKAFAAGADIAAMRGWDYMDVFKSNYITRNWETLRNVRKPVIAAVAGYALGGGC
ELAMACDILIAADNAVFGLPELKLAVIPGAGGTQRLPRAISKAKAMDMCMTARNMDADEA
ERSGLVSRVVAAGRLMDEAMAVAQTIAGFSLPSMMAVKEAINRACESSLSEGMLFERRQL
HALFATEDLKEGMNAFLERRAAVFRHR
NT seq 804 nt   +upstreamnt  +downstreamnt
gtgaccgcgcatgaagccacgccggcgatcgacgagaacctggtactgctggagatggtc
ggccgcgtcgccgtgatccgcctcaatcgtccccggcagatgaacgcgctcaacgatgcg
ctgatggatgcgctcggcctggcgctgctggcgtgtgagcaagacgacggcgtcggcgcc
atcgtgatcaccggcaacgacaaggccttcgccgccggcgcggacatcgcagccatgcgc
ggctgggactatatggacgtgttcaagtccaactacatcacgcgcaactgggagacgctg
cgcaatgtgcgcaagccagtgatcgccgcggtcgcgggctacgcgcttggcggcggctgc
gagctggccatggcctgcgacattctcatcgcggcggacaacgcggtgttcggcctgccc
gaactgaagctcgcggtcatcccaggcgcgggcggcacgcagcgcctgccgcgcgccatc
tccaaggcgaaagccatggacatgtgcatgacggcgcgcaacatggatgcggatgaagcg
gagcgcagcgggctggtatcgcgggtggtggccgccgggcggttgatggatgaagcgatg
gcggtggcgcagacgattgccggcttctcgctgccgtcgatgatggcggtcaaggaggcg
atcaaccgcgcttgcgagtcatcgctgtccgagggcatgctgttcgagcggcggcagttg
catgcgctgtttgccacggaggatctgaaggaggggatgaatgcgtttttggagagaagg
gcggcggtgttccggcaccgctag

DBGET integrated database retrieval system