KEGG   Cupriavidus basilensis: RR42_s0828Help
Entry
RR42_s0828        CDS       T03642                                 

Definition
(GenBank) Aldehyde dehydrogenase
Organism
cbw  Cupriavidus basilensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJG22418
UniProt: A0A0C4YHF0
LinkDB All DBs
Position
secondary:complement(910456..911916)
Genome map
AA seq 486 aa AA seqDB search
MTNRTIELKHPRQLYIDGEWVEPFTSGVFDVLDCSTEQVVATVARAESSDMQRAVAAARR
AFDDGPWPRMTPMERAAFLERIATRLEALNDEFARIWSLETGIVYQVAQPRIGLFISGAF
RQYAAMASTFPFTQPCQSVTGNDAYRVYEPVGVVAEIIPWNGPAGLLAYKTAPALLAGCT
LVIKSPPEAPCSGYLFAQVCEEVGLPPGVVNVITAERDVSEALVRSQDVDKITFTGSTAA
GRRIASIAGDRVARVTLELGGKSPAVVLDDYDVETAAATLGNSYFGYNAGQICHSLTRII
VPRAKHGTMVEALSAIARQIVLGDPLAAETTSGPLASARQRDTVERFVAMGVEEGAVLAA
GGKRPSHLARGFFFEPTVFGNVDNRSSIAQQEIFGPVLSVIPADDEASAIRMANDTPFGL
NAAVFTNDRERALAVARQIRAGTVGHNGPRTDFSIGFGGFKQSGIGREGGVEGLTAFMES
KTIVLA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaccgaaccattgaactcaagcacccgcgtcagctttacatcgacggcgaatgg
gtcgaaccctttaccagcggcgtcttcgacgtgctggactgctcaacggagcaggtcgtc
gcgacggttgcccgcgccgagtcgtccgacatgcagcgcgccgtcgccgccgcgcgcagg
gcattcgacgatggcccgtggccacgcatgacgccgatggagcgcgccgccttcctcgag
aggattgccacgcggctcgaagccctgaacgacgagttcgcccgtatctggtcgctggaa
accggcattgtctaccaggtcgcgcagccgcggatcgggctgttcatcagcggcgccttc
cggcagtacgcggcgatggcatcgaccttccctttcacgcagccgtgccagtcggtcacc
ggcaacgacgcatatcgcgtctacgagccggtgggcgtggtcgcagagatcattccctgg
aacggtcccgcagggttgctcgcctacaagacggcgccggcgctgctggctggctgcacg
ctggtcatcaagtcgccgcccgaggcgccatgctcgggctacctgttcgcgcaggtttgc
gaggaagtcgggttgcccccgggcgtcgtcaacgtcattacggccgaacgcgacgtgtcc
gaggcgctggtgcgcagccaggacgtcgacaagatcacattcaccggttcgaccgcggcc
ggccgccgcatcgcgtccatcgccggcgaccgcgtggcgcgcgtgacgctggaactcggc
ggcaagtcgcctgccgtcgtcctggacgactacgacgtcgaaactgccgccgccacgctt
ggcaactcctacttcggctacaacgccgggcagatctgccacagcctgacccgcatcatc
gtgccgcgcgcgaagcacggcacgatggtggaggcgctgtccgccatcgcgcggcagatc
gtgctcggtgacccgctcgcggcggagaccacctccggccccctcgccagtgcccgccag
cgcgacaccgtcgagcgcttcgtcgccatgggggtggaggaaggcgcggtgctggcggcc
ggcggcaagcggccgtcacatctggcgcgcggcttcttcttcgagccgacggtgttcggc
aatgtcgataaccgctcgagcatcgcccagcaggagatcttcggccccgtgctgagcgtg
attccggccgacgacgaggccagcgccatccgcatggcgaacgacacgccgttcggcctg
aacgccgccgtcttcaccaacgaccgtgagcgtgcgctcgcggtggcgcggcagatccgc
gcgggcaccgtgggccacaatggcccgcgcaccgacttctccatcggcttcggcggcttc
aagcagtcgggcatcggccgcgagggcggcgttgaaggactgaccgccttcatggagtca
aagaccatcgtgctggcctga

DBGET integrated database retrieval system