KEGG   Cupriavidus basilensis: RR42_s1120Help
Entry
RR42_s1120        CDS       T03642                                 

Definition
(GenBank) Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cbw  Cupriavidus basilensis
Pathway
cbw00250  Alanine, aspartate and glutamate metabolism
cbw00410  beta-Alanine metabolism
cbw00640  Propanoate metabolism
cbw00650  Butanoate metabolism
cbw01100  Metabolic pathways
cbw01120  Microbial metabolism in diverse environments
Module
cbw_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cbw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    RR42_s1120
   00650 Butanoate metabolism
    RR42_s1120
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RR42_s1120
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RR42_s1120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cbw01007]
    RR42_s1120
Enzymes [BR:cbw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RR42_s1120
Amino acid related enzymes [BR:cbw01007]
 Aminotransferase (transaminase)
  Class III
   RR42_s1120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJG22709
UniProt: A0A0C4YL49
LinkDB All DBs
Position
secondary:1244493..1245827
Genome map
AA seq 444 aa AA seqDB search
MALAVQIQIQIQTRQQDTNAMEHAMKNADLVRRKDAATPRGVGVMCNFYAERAENSELWD
VEGNRYIDFAAGIAVLNTGHRHPRLVQAMQAQMERFTHTAYQIVPYASYIELAEKINARA
PGAFAKKTAFFTTGAEAVENAIKIARAATGRPGVIAFSGGFHGRTMMGMALTGKVVPYKV
GFGPFPGDVFHAPYPYGLHGVSVQDSINALHQLFKADVDPKRVAAIIFEPVQGEGGFNVA
PAEFVRALRAICDEHGILLVADEVQTGFGRTGKLFAMEHYDVTPDLTTMAKSLAGGMPLS
AVCGRAEIMDAPAPGGLGGTYAGNPLAVASALAVLDVLESEKLIERGAALGQRLQDKLDG
LKSRVPEIGEVRGVGAMIAVEFRKADGRPDPEFTRQVQDRALERGLLLLSCGVYGNVVRF
LFPLTIPDAVMDEGLGILEAALLQ
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctagccgtccagatccagatccagatccagacaagacagcaggacaccaatgca
atggagcatgcaatgaagaacgcagacctggtacgccgcaaagatgccgccacgccccgt
ggcgttggtgtgatgtgcaacttctatgccgagcgcgccgaaaactcggaactgtgggat
gtcgaaggcaaccgctacatcgacttcgcggccggcatcgccgtgctcaataccggtcac
cgccatccgcgcctggtgcaagccatgcaggcgcagatggagcgcttcacgcacaccgcc
taccagatcgtgccctacgccagctatatcgaactggccgagaagatcaacgcccgcgcg
ccgggcgcgttcgccaagaagaccgcgtttttcaccaccggcgccgaggccgtcgagaac
gccatcaagattgcccgtgcggccaccgggcgccctggcgtcattgccttctctggcggt
ttccacggccgcaccatgatgggcatggcgctgaccggcaaggtcgtgccgtacaaggtg
gggtttggcccgttcccgggcgacgtgttccacgcgccctacccgtacgggttgcatggc
gtgagcgtgcaggattcgatcaacgcgctgcaccagttgttcaaggcggacgtggacccg
aagcgggtcgcggccatcatcttcgagccggtccagggcgagggcggtttcaacgtggca
cccgccgagttcgtgcgcgcgctgcgcgccatctgcgacgagcacggcatcctgctggtg
gccgatgaggtgcagacgggatttggccgcaccggcaagctcttcgccatggagcactac
gacgtcacgccggacctgaccaccatggccaagagcctggccggcggcatgcctttgtcg
gccgtttgcggccgggccgagatcatggacgcgccggcccccggcgggctgggcggcacc
tacgccggcaacccgctggcggtggcttcggcgctggcggtgctggacgtgctggagagc
gagaagctgatcgagcgcggcgccgcgctcggccagcggctgcaggacaagctcgatggc
ctgaagtcgcgcgtgccggagatcggcgaggtgcgcggcgtgggcgccatgattgccgtg
gagttccgcaaggccgacggccgccccgatcccgaattcacgcggcaagtgcaagaccgc
gccctggagcgcggcctgctgctgctctcctgcggagtctacggcaacgtggtgcgcttc
ctgttcccgctgaccatccccgatgccgtgatggacgaagggctgggcatcctggaggcc
gcgctcctgcagtaa

DBGET integrated database retrieval system