Cupriavidus basilensis: RR42_s2184 Help Entry RR42_s2184        CDS       T03642                                  Name (GenBank) Acyl carrier protein (ACP1)   KO K02078   acyl carrier protein Organism cbw  Cupriavidus basilensis Pathway cbw00998   Biosynthesis of various antibiotics cbw01100   Metabolic pathways cbw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cbw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RR42_s2184   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RR42_s2184 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AJG23766 UniProt:  A0A0C4YSY1 LinkDB All DBs Position secondary:complement(2387711..2387986) Genome browser AA seq 91 aa AA seqDB search MKALEQEIKELIISSLSLEDIGVDDIDADAPLFIEGLGLDSIDALELGLALQKRYGVTMN GDKEDMRARFASVTALATFVASQQRAGQASA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt gtgaaggcgcttgagcaagaaatcaaggaactgatcatttcatcgttgtcgctggaggat atcggcgtggacgatatcgacgccgacgcgccgctgttcatcgaagggctgggcctggat tcgatcgatgcgctcgaactcgggctggcgctgcaaaagcgctacggcgtgaccatgaac ggcgacaaggaagacatgcgcgcgcgctttgccagcgtcacagcgctggccacgttcgtc gcatctcagcagcgcgctggtcaggcttctgcctga

DBGET integrated database retrieval system